DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and Swim

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_611652.2 Gene:Swim / 37537 FlyBaseID:FBgn0034709 Length:431 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:112/277 - (40%) Gaps:53/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 KTEEELKARRGYKSSGIYNTGKPFPYDVPKYK-----------DEIPDQYD----WRLYGAVTPV 345
            |..|.||.|.|.|.              |.|:           |.:|..::    |..|  ::.|
  Fly   156 KYSEGLKLRLGTKE--------------PTYRVKAMTRLKNPTDGLPSSFNALDKWSSY--ISEV 204

  Fly   346 KDQSVCGSCWSFGTIGHLEGAFFLKN-GGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQ 409
            .||..||:.|...|.......|.::: |...|:||.|.::.|:  ....||:||.....::::.:
  Fly   205 PDQGWCGASWVLSTTSVASDRFAIQSKGKENVQLSAQNILSCT--RRQQGCEGGHLDAAWRYLHK 267

  Fly   410 SGGVPTEEEYGPYLGQDGYCHVNNVTLVAPIKGF---VNVT-----------SNDPNAFKLALLK 460
            .|.|  :|...||......|.:.:.:......|.   |||.           |.:..|..:|.:.
  Fly   268 KGVV--DENCYPYTQHRDTCKIRHNSRSLRANGCQKPVNVDRDSLYTVGPAYSLNREADIMAEIF 330

  Fly   461 H-GPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYG-SINGEDYWLVKNSWSTYW 523
            | ||:...:..: :.|..||.|||.|...........|:|..||:| ..|||.||:..|||.::|
  Fly   331 HSGPVQATMRVN-RDFFAYSGGVYRETAANRKAPTGFHSVKLVGWGEEHNGEKYWIAANSWGSWW 394

  Fly   524 GNDGYILMSAKKNNCGV 540
            |..||..:....|.||:
  Fly   395 GEHGYFRILRGSNECGI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 1/3 (33%)
Peptidase_C1A 331..547 CDD:239068 64/231 (28%)
SwimNP_611652.2 Somatomedin_B 41..83 CDD:279385
VWC 91..>126 CDD:302663
Peptidase_C1A_CathepsinB 188..417 CDD:239111 64/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.