DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment 26-29-p and cer

DIOPT Version :9

Sequence 1:	NP_620470.1	Gene:	26-29-p / 39547	FlyBaseID:	FBgn0250848	Length:	549	Species:	Drosophila melanogaster
Sequence 2:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster

Alignment Length:	71	Identity:	22/71 - (30%)
Similarity:	36/71 - (50%)	Gaps:	5/71 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   242 DKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKNR----AKLTYTLAVNHLADKTEEELK 302
            |:.:..:|.|....|.:: |...|:.|:.::...|...||    .::|:.:.:|||||.|.||..
  Fly     6 DEEWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFA 69

  Fly   303 ARRGYK 308
            .|.|.|
  Fly    70 QRCGKK 75

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
26-29-p	NP_620470.1	Inhibitor_I29	245..300	CDD:214853	16/58 (28%)
26-29-p	NP_620470.1	Peptidase_C1A	331..547	CDD:239068
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	17/59 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900