DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and Ctsz

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:279 Identity:79/279 - (28%)
Similarity:124/279 - (44%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 NHLADKTEEELKARRGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWR-----LYGAVTPVKDQSV 350
            :|||      |..||.|.        :|..|..|.   ::|..:|||     .|.:||  ::|.:
  Rat    42 DHLA------LLGRRTYP--------RPHEYLSPA---DLPKNWDWRNVNGVNYASVT--RNQHI 87

  Fly   351 ---CGSCWSFGTIGHLEGAFFLKNGG--NLVRLSQQALIDCSWAYGNNG-CDGGEDFRVYQWMLQ 409
               |||||:.|:...|.....:|..|  ....||.|.:|||    ||.| |:||.|..|::: ..
  Rat    88 PQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDC----GNAGSCEGGNDLPVWEY-AH 147

  Fly   410 SGGVPTEEEYGPYLGQDGYCH----------------VNNVTLVAPIKGFVNVTSNDPNAFKLAL 458
            ..|:| :|....|..:|..|.                :.|.||.. :..:.:::..:  .....:
  Rat   148 KHGIP-DETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWR-VGDYGSLSGRE--KMMAEI 208

  Fly   459 LKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYG-SINGEDYWLVKNSWSTY 522
            ..:||:|..|.|:.: .|.|:.|:|.|  .:|... ::|.:...|:| |.:|.:||:|:|||...
  Rat   209 YANGPISCGIMATER-MSNYTGGIYTE--YQNQAI-INHIISVAGWGVSNDGIEYWIVRNSWGEP 269

  Fly   523 WGNDGY--ILMSAKKNNCG 539
            ||..|:  |:.|..|...|
  Rat   270 WGERGWMRIVTSTYKGGTG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 3/8 (38%)
Peptidase_C1A 331..547 CDD:239068 69/239 (29%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 69/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.