DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and C32B5.7

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:225 Identity:66/225 - (29%)
Similarity:104/225 - (46%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 RGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHLEGAFFL 369
            :.||     |..|||              .|||..|.|.|||||..|.:.::|..|..:|..:.:
 Worm    46 QNYK-----NAKKPF--------------LDWRDEGVVGPVKDQGNCNASYAFAAISAIESMYAI 91

  Fly   370 KNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLG-QDGYCHVNN 433
            .| |.|:..|:|.:|||.     .||....|..:....|:..|:.|..:| |::| ::..|..::
 Worm    92 AN-GQLLSFSEQQIIDCL-----GGCAIESDPMMAMTYLERKGIETYTDY-PFVGKKNEKCEYDS 149

  Fly   434 VTLVAPIKGFVNVTSN-DPNAFKLALL---KHGPLSVAIDASPKTFSFYSHGVYYEPT---CKND 491
            .      |.::.:... |.:...|||:   :.||....::..|..|: |..|: |.||   ||:.
 Worm   150 K------KAYLILDDTYDMSDESLALVFIDERGPGLFTMNTPPSFFN-YKSGI-YNPTEEECKST 206

  Fly   492 VDGLDHAVLAVGYGSINGEDYWLVKNSWST 521
            .:  ..|:..||||:..|::||:||.|:.|
 Worm   207 NE--KRALTIVGYGNDKGQNYWIVKGSFGT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853
Peptidase_C1A 331..547 CDD:239068 60/199 (30%)
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 59/194 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.