DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and cpr-1

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_506002.2 Gene:cpr-1 / 179637 WormBaseID:WBGene00000781 Length:329 Species:Caenorhabditis elegans


Alignment Length:289 Identity:76/289 - (26%)
Similarity:114/289 - (39%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 TEEELKARRGYKSSGIYNTGKPFPYDVPKYKDEI------------PDQYD----WRLYGAVTPV 345
            ||||:|.:   ...|.|         ...:.|||            |..:|    |....::..:
 Worm    52 TEEEMKFK---LMDGKY---------AAAHSDEIRATEQEVVLASVPATFDSRTQWSECKSIKLI 104

  Fly   346 KDQSVCGSCWSFGTIGHLEGAFFLK-NGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQ 409
            :||:.|||||:||....:.....:: .|.....:|...|:.|..:...|||:||...:..:|. .
 Worm   105 RDQATCGSCWAFGAAEMISDRTCIETKGAQQPIISPDDLLSCCGSSCGNGCEGGYPIQALRWW-D 168

  Fly   410 SGGVPTEEEY-----GPY--------------------LGQDGYCHVNNVTLVAPIKGF-VNVTS 448
            |.||.|..:|     .||                    ..|.||.     |..|..|.| |:..:
 Worm   169 SKGVVTGGDYHGAGCKPYPIAPCTSGNCPESKTPSCSMSCQSGYS-----TAYAKDKHFGVSAYA 228

  Fly   449 NDPNA--FKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYGSINGED 511
            ...||  .:..:..:||:..|.... :.|..|..|| |:.|....:.|  ||:..:|:|:.:|..
 Worm   229 VPKNAASIQAEIYANGPVEAAFSVY-EDFYKYKSGV-YKHTAGKYLGG--HAIKIIGWGTESGSP 289

  Fly   512 YWLVKNSWSTYWGNDGYILMSAKKNNCGV 540
            ||||.|||...||..|:..:....:.||:
 Worm   290 YWLVANSWGVNWGESGFFKIYRGDDQCGI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 2/2 (100%)
Peptidase_C1A 331..547 CDD:239068 66/243 (27%)
cpr-1NP_506002.2 Peptidase_C1A_CathepsinB 86..325 CDD:239111 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.