DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and cpz-1

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_491023.2 Gene:cpz-1 / 171829 WormBaseID:WBGene00000788 Length:306 Species:Caenorhabditis elegans


Alignment Length:277 Identity:77/277 - (27%)
Similarity:118/277 - (42%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 RRGYKSSGIY-NTGKPFP-------YDVPKY-KDEIPDQYDWRLYGAV---TPVKDQSV---CGS 353
            |..|...|.| .||:.|.       |:...: .:::|..:|||....:   :..::|.:   |||
 Worm    30 RNRYNLKGCYKQTGRVFEHKRYDRIYETEDFDSEDLPKTWDWRDANGINYASADRNQHIPQYCGS 94

  Fly   354 CWSFGTIGHLEGAFFL--KNGGNLVRLSQQALIDCSWAYGNNGC-DGGEDFRVYQWMLQSGGVPT 415
            ||:||....|.....:  ||......||.|.:||||   |...| .|||...||:: ....|:| 
 Worm    95 CWAFGATSALADRINIKRKNAWPQAYLSVQEVIDCS---GAGTCVMGGEPGGVYKY-AHEHGIP- 154

  Fly   416 EEEYGPYLGQDGYC---------------HVNNVTL-----VAPIKGFVNVTSNDPNAFKLALLK 460
            .|....|..:||.|               .:.|.||     ...:.|:        ...|..:..
 Worm   155 HETCNNYQARDGKCDPYNRCGSCWPGECFSIKNYTLYKVSEYGTVHGY--------EKMKAEIYH 211

  Fly   461 HGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYG--SINGEDYWLVKNSWSTYW 523
            .||::..| |:.|.|..|:.|:|.|.|   |.| :||.:...|:|  ..:|.:||:.:|||...|
 Worm   212 KGPIACGI-AATKAFETYAGGIYKEVT---DED-IDHIISVHGWGVDHESGVEYWIGRNSWGEPW 271

  Fly   524 GNDGYI-LMSAKKNNCG 539
            |..|:. :::::..|.|
 Worm   272 GEHGWFKIVTSQYKNAG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853
Peptidase_C1A 331..547 CDD:239068 69/241 (29%)
cpz-1NP_491023.2 Peptidase_C1A_CathepsinX 65..305 CDD:239149 69/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.