DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CTSZ

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001327.2 Gene:CTSZ / 1522 HGNCID:2547 Length:303 Species:Homo sapiens


Alignment Length:285 Identity:78/285 - (27%)
Similarity:128/285 - (44%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 LADKTEEELKARRG------YKSSGIYNTGK---PFPYDVPKYKDEIPDQYDWR-----LYGAVT 343
            ||...:..|..|||      .:..|:...|:   |.|::.....| :|..:|||     .|.::|
Human    17 LAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPAD-LPKSWDWRNVDGVNYASIT 80

  Fly   344 PVKDQSV---CGSCWSFGTIGHLEGAFFLKNGG--NLVRLSQQALIDCSWAYGNNG-CDGGEDFR 402
              ::|.:   |||||:..:...:.....:|..|  ....||.|.:|||    ||.| |:||.|..
Human    81 --RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDC----GNAGSCEGGNDLS 139

  Fly   403 VYQWMLQSGGVPTEEEYGPYLGQD---------GYCH-------VNNVTLVAPIKGFVNVTSNDP 451
            |:.:..|. |:| :|....|..:|         |.|:       :.|.||.. :..:.:::..: 
Human   140 VWDYAHQH-GIP-DETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWR-VGDYGSLSGRE- 200

  Fly   452 NAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYGSINGEDYWLVK 516
             .....:..:||:|..|.|:.: .:.|:.|:|.|   ..|...::|.|...|:|..:|.:||:|:
Human   201 -KMMAEIYANGPISCGIMATER-LANYTGGIYAE---YQDTTYINHVVSVAGWGISDGTEYWIVR 260

  Fly   517 NSWSTYWGNDGY--ILMSAKKNNCG 539
            |||...||..|:  |:.|..|:..|
Human   261 NSWGEPWGERGWLRIVTSTYKDGKG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 2/6 (33%)
Peptidase_C1A 331..547 CDD:239068 67/238 (28%)
CTSZNP_001327.2 Peptidase_C1A_CathepsinX 62..302 CDD:239149 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.