DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CTSO

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:298 Identity:97/298 - (32%)
Similarity:141/298 - (47%) Gaps:43/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 EHRKNIFRQNL---RYIH----SKNRAKLTYTLAVNHLADKTEEELKARRGYKSSGIYNTGKPFP 320
            |.....||::|   ||::    |:|.   |....:|..:....||.||        ||...||..
Human    38 EREAAAFRESLNRHRYLNSLFPSENS---TAFYGINQFSYLFPEEFKA--------IYLRSKPSK 91

  Fly   321 YDVPKYKDEI---------PDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHLEGAFFLKNGGNLV 376
            :  |:|..|:         |.::|||....||.|::|.:||.||:|..:|.:|.|:.:| |..|.
Human    92 F--PRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIK-GKPLE 153

  Fly   377 RLSQQALIDCSWAYGNNGCDGGEDFRVYQWM--LQSGGVPTEEEYGPYLGQDGYCHVNNVTLVA- 438
            .||.|.:||||  |.|.||:||.......|:  :|...| .:.|| |:..|:|.||..:.:... 
Human   154 DLSVQQVIDCS--YNNYGCNGGSTLNALNWLNKMQVKLV-KDSEY-PFKAQNGLCHYFSGSHSGF 214

  Fly   439 PIKGFVNVT-SNDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAV 502
            .|||:.... |:..:....|||..|||.|.:||  .::..|..|:........:.   :||||..
Human   215 SIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDA--VSWQDYLGGIIQHHCSSGEA---NHAVLIT 274

  Fly   503 GYGSINGEDYWLVKNSWSTYWGNDGYILMSAKKNNCGV 540
            |:.......||:|:|||.:.||.|||..:....|.||:
Human   275 GFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 10/43 (23%)
Peptidase_C1A 331..547 CDD:239068 76/214 (36%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 76/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.