DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CTSL

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:317 Identity:122/317 - (38%)
Similarity:173/317 - (54%) Gaps:32/317 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 KAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKNR----AKLTYTLAVNHLADKTEEELKA 303
            ||.|:  |.:|:     .|...|:.::.:|::.|...|:    .|.::|:|:|...|.|.||.: 
Human    33 KAMHN--RLYGM-----NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFR- 89

  Fly   304 RRGYKSSGIYN----TGKPFPYDVPKYKDEIPDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHLE 364
               ...:|..|    .||.|  ..|.:. |.|...|||..|.|||||:|..|||||:|...|.||
Human    90 ---QVMNGFQNRKPRKGKVF--QEPLFY-EAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALE 148

  Fly   365 GAFFLKNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGYC 429
            |..|.|. |.|:.||:|.|:|||...||.||:||.....:|::..:||:.:||.| ||...:..|
Human   149 GQMFRKT-GRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESY-PYEATEESC 211

  Fly   430 HVNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDG 494
            ..|....||...|||::...: .|...|:...||:||||||..::|.||..|:|:||.|.:  :.
Human   212 KYNPKYSVANDTGFVDIPKQE-KALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSS--ED 273

  Fly   495 LDHAVLAVGYGSINGED----YWLVKNSWSTYWGNDGYILMSA-KKNNCGVMTMPTY 546
            :||.||.||||..:.|.    ||||||||...||..||:.|:. ::|:||:.:..:|
Human   274 MDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 14/58 (24%)
Peptidase_C1A 331..547 CDD:239068 97/221 (44%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 16/60 (27%)
Peptidase_C1 114..332 CDD:395062 97/222 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.