DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CTSB

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001371643.1 Gene:CTSB / 1508 HGNCID:2527 Length:339 Species:Homo sapiens


Alignment Length:277 Identity:69/277 - (24%)
Similarity:112/277 - (40%) Gaps:62/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 GIYNTGKPFPYDVPKYKD-EIPDQYD----WRLYGAVTPVKDQSVCGSCWSFGTIGHLEGAFFLK 370
            |.:..|...|..|...:| ::|..:|    |.....:..::||..|||||:||.:..:.....:.
Human    60 GTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIH 124

  Fly   371 NGGNL-VRLSQQALIDCSWAYGNNGCDGGEDFRVYQ-WM---LQSGGV-------------PTEE 417
            ...:: |.:|.:.|:.|..:...:||:||.....:. |.   |.|||:             |.|.
Human   125 TNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEH 189

  Fly   418 E------------------------YGPYLGQDGYCHVNNVTLVAPIKGFVNVTSNDPNAFKLAL 458
            .                        |.|...||.:...|:.::           ||........:
Human   190 HVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSV-----------SNSEKDIMAEI 243

  Fly   459 LKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYGSINGEDYWLVKNSWSTYW 523
            .|:||:..|.... ..|..|..|||...|  .::.| .||:..:|:|..||..||||.|||:|.|
Human   244 YKNGPVEGAFSVY-SDFLLYKSGVYQHVT--GEMMG-GHAIRILGWGVENGTPYWLVANSWNTDW 304

  Fly   524 GNDGYILMSAKKNNCGV 540
            |::|:..:...:::||:
Human   305 GDNGFFKILRGQDHCGI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853
Peptidase_C1A 331..547 CDD:239068 64/256 (25%)
CTSBNP_001371643.1 Propeptide_C1 26..65 CDD:400445 1/4 (25%)
Peptidase_C1A_CathepsinB 81..328 CDD:239111 64/256 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.