DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and Ctla2a

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_031822.2 Gene:Ctla2a / 13024 MGIID:88554 Length:137 Species:Mus musculus


Alignment Length:115 Identity:32/115 - (27%)
Similarity:57/115 - (49%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DEHVDKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKN----RAKLTYTLAVNHLADKTE 298
            |..:|..:..:|.|...||:.: |..||:.::.:|.:.|.:.|    :.|.::.:.:|..:|.|.
Mouse    33 DPSLDNEWKEWKTKFAKAYNLN-EERHRRLVWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTP 96

  Fly   299 EELKARRGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWRLYGAVTPVKDQ 348
            ||.|. ..|.:|  .|.|:..| |:|:|:|...:.|       :||.:.|
Mouse    97 EEFKT-NCYGNS--LNRGEMAP-DLPEYEDLGKNSY-------LTPGRAQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 14/58 (24%)
Peptidase_C1A 331..547 CDD:239068 4/18 (22%)
Ctla2aNP_031822.2 2 X 3 AA tandem repeats of E-W-K 39..44 0/4 (0%)
Inhibitor_I29 40..98 CDD:214853 14/58 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.