DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CTSC

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:311 Identity:90/311 - (28%)
Similarity:148/311 - (47%) Gaps:37/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VAYHSDTEHEHRKNIFRQNLRYIHSKNRAKLTYTLAVNHLADKTEEELKARRGYKSSGIYNTGKP 318
            :|:..:::.::...:::.:..::.:.|..:.::| |..::..:|   |......:.||.::...|
Human   153 IAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWT-ATTYMEYET---LTLGDMIRRSGGHSRKIP 213

  Fly   319 FPYDVPKYKD------EIPDQYDWR-LYGA--VTPVKDQSVCGSCWSFGTIGHLEGAF-FLKNGG 373
            .|...|...:      .:|..:||| ::|.  |:||::|:.||||:||.::|.||... .|.|..
Human   214 RPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNS 278

  Fly   374 NLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGYC--------- 429
            ....||.|.::.|| .|. .||:||..:.:.....|..|: .||...||.|.|..|         
Human   279 QTPILSPQEVVSCS-QYA-QGCEGGFPYLIAGKYAQDFGL-VEEACFPYTGTDSPCKMKEDCFRY 340

  Fly   430 HVNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCK---ND 491
            :.:....|....|..|..     ..||.|:.|||::||.:.. ..|..|..|:|:....:   |.
Human   341 YSSEYHYVGGFYGGCNEA-----LMKLELVHHGPMAVAFEVY-DDFLHYKKGIYHHTGLRDPFNP 399

  Fly   492 VDGLDHAVLAVGYG--SINGEDYWLVKNSWSTYWGNDGYILMSAKKNNCGV 540
            .:..:||||.||||  |.:|.|||:|||||.|.||.:||..:....:.|.:
Human   400 FELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 5/45 (11%)
Peptidase_C1A 331..547 CDD:239068 79/228 (35%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344
Peptidase_C1A_CathepsinC 231..460 CDD:239112 79/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.