DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and LOC100332358

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_021333584.1 Gene:LOC100332358 / 100332358 -ID:- Length:258 Species:Danio rerio


Alignment Length:266 Identity:86/266 - (32%)
Similarity:135/266 - (50%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VKTYQLAGEGQYGTLLKLAPITTKTENNKLTCLQVNGTADQAVDIQSILPDAKPF-SLVGTESFL 129
            |:|:|:..:..:|.:.|:.|:...::   :.|.|:.||.|..|:.|..:|||:.| .....|...
Zfish    13 VRTFQIGNDLDFGAIYKITPVLPPSD---IKCFQLKGTKDDPVEPQEAIPDAQSFKQFEKMEDCK 74

  Fly   130 GYTCDKFRLESTIGQKKNIYTLWVRYKKSPHYPSSRMPIPVRYEMRGYNTLLGSHYDHYYLDYDS 194
            |..|:.::..:..|.|||.|.|||...::.:.|::    |.|:||.|:.:|||||.|.|.::|..
Zfish    75 GVQCEVWKKVTEAGHKKNTYRLWVTRGEAAYSPAT----PHRFEMEGFKSLLGSHNDKYSIEYSE 135

  Fly   195 YEHDDIPNEVFEIDDSLQCVGFPGPGTGHYATFNPMQEFISGTDE-HVDKAFHHFKRKHGVAYHS 258
            :.....| :||.......|..||.|........||.:::::.... |..:.|..||.|....|.|
Zfish   136 FCTQSEP-DVFTPPAGFTCEEFPDPPEERQILANPFRDYVNTHPVCHAHRMFSPFKEKFNRQYES 199

  Fly   259 DTEHEHRKNIFRQNLRYIHSKNRAKLTYTLAVNHLADKTEEELKARRGYKSSGIYNTGKPFPYDV 323
            :.|||.|:|:|....|::||.|||.|||::.:||.||| ::||....|    |::          
Zfish   200 EKEHEERENLFLHTFRFVHSNNRAGLTYSVGINHFADK-KKELARMTG----GLH---------- 249

  Fly   324 PKYKDE 329
            ||.|.|
Zfish   250 PKKKKE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 26/54 (48%)
Peptidase_C1A 331..547 CDD:239068
LOC100332358XP_021333584.1 Inhibitor_I29 186..240 CDD:214853 26/54 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581676
Domainoid 1 1.000 194 1.000 Domainoid score I3120
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.