DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and si:dkey-267n13.1

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_002665630.2 Gene:si:dkey-267n13.1 / 100001286 ZFINID:ZDB-GENE-141211-35 Length:292 Species:Danio rerio


Alignment Length:281 Identity:98/281 - (34%)
Similarity:146/281 - (51%) Gaps:9/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKWDPNYIVKGTLYIPYAEIAEPFYAWYDKNTRRSRIDYYGGMVKTYQLAGEGQYGTLLKLAPIT 87
            |.:...|.|||.:.:|..||.|||.||||....|||||||.|.|.|:.:..:..||.:.::.|: 
Zfish    17 PDFGKMYHVKGVISLPSYEIEEPFEAWYDFERNRSRIDYYNGTVCTFLIGNDLDYGAIYQIRPV- 80

  Fly    88 TKTENNKLTCLQVNGTADQAVDIQSILPDAKPFSLVGTESFLGYTCDKFRLESTIGQKKNIYTLW 152
              ...|.:.|.|:.||.::.:..||.:||.:.|.....:...|..|:.::..:..|.|||.|.||
Zfish    81 --LPTNDIKCFQLKGTKEEPIQPQSAMPDVQGFEFEKMDYHKGSRCEVWKTVTEAGHKKNTYRLW 143

  Fly   153 VRYKKSPHYPSSRMPIPVRYEMRGYNTLLGSHYDHYYLDYDSYEHDDIPNEVFEIDDSLQCVGFP 217
            |...:....|::    |.|:||.|:||||.||.|.|.::|..:.....| :||.......|..||
Zfish   144 VTRPEGNDAPAT----PHRFEMEGFNTLLDSHNDKYSIEYSDFCTQSEP-DVFTPPAGFTCEEFP 203

  Fly   218 GPGTGHYATFNPMQEFISGTD-EHVDKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKNR 281
            .|...|....||:|:::|... .|..:.|..||.|....|.|:.|||.|:..|.|:.|:::|.||
Zfish   204 DPPEEHQILANPIQDYVSTNPVSHAHRMFGPFKEKFNRQYKSEKEHEKREINFVQSFRFVNSTNR 268

  Fly   282 AKLTYTLAVNHLADKTEEELK 302
            ..|::|:.:|..||.:..|.:
Zfish   269 KGLSFTVGINDRADWSRAETR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 21/54 (39%)
Peptidase_C1A 331..547 CDD:239068
si:dkey-267n13.1XP_002665630.2 Inhibitor_I29 232..287 CDD:285458 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581678
Domainoid 1 1.000 194 1.000 Domainoid score I3120
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.