DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-1 and HSPA12B

DIOPT Version :9

Sequence 1:NP_524063.1 Gene:Hsc70-1 / 39542 FlyBaseID:FBgn0001216 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_443202.3 Gene:HSPA12B / 116835 HGNCID:16193 Length:686 Species:Homo sapiens


Alignment Length:652 Identity:134/652 - (20%)
Similarity:222/652 - (34%) Gaps:188/652 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGIDLGTTYSCVGVFQHGKVEII-------ANDQG--NRTTPSYVAFTESERL--IGDAAKNQV- 59
            |.||.|||.|..........|.|       ..|.|  ::.||:.:..|.....  .|..|::.. 
Human    63 VAIDFGTTSSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLTPEGAFHSFGYTARDYYH 127

  Fly    60 AMNPNNT----IFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVS 120
            .::|...    .|:..::......|.|:::.::       |.|||....:|.......|:.|.  
Human   128 DLDPEEARDWLYFEKFKMKIHSATDLTLKTQLE-------AVNGKTMPALEVFAHALRFFREH-- 183

  Fly   121 SMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGL------NVLRIINEPTAA 179
              .|.::||.:.:.........|:||||.:....:|..::|..:|||      ..|.|..||.||
Human   184 --ALQELREQSPSLPEKDTVRWVLTVPAIWKQPAKQFMREAAYLAGLVSRENAEQLLIALEPEAA 246

  Fly   180 AI----------------AYG------------------------------LDKQGTSE------ 192
            ::                |.|                              |.:.|..|      
Human   247 SVYCRKLRLHQLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQ 311

  Fly   193 --RNVLIFDLGGGTFDVSVLTIED--GIFE--VKATAGDTHLGGED--FDNRLVNHFVQEFQRKH 249
              ...::.|.||||.|::|..:|.  |..:  .||:.|.....|.|  |:..|...|.::|....
Human   312 AGDRYVVADCGGGTVDLTVHQLEQPHGTLKELYKASGGPYGAVGVDLAFEQLLCRIFGEDFIATF 376

  Fly   250 KKDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFY---------TSVTRARFE-- 303
            |:   |...|...|..|.|..|||.......::.|...|..:|||         |::.|:...  
Human   377 KR---QRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFSFIDFYRKQRGHNVETALRRSSVNFV 438

  Fly   304 ------------ELNGDLFRGTMEPVAKALRDAKMDKGQIHDI---VLVGGSTRIPKVQRLLQDF 353
                        |...:||:.|:..:.:.: :|.:.:.::..:   .||||......:|..:|..
Human   439 KWSSQGMLRMSCEAMNELFQPTVSGIIQHI-EALLARPEVQGVKLLFLVGGFAESAVLQHAVQAA 502

  Fly   354 FNGKELNKSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTTLIKRNT 418
            ...:.|...:..|..:   ..::.|:|.|.....|:    :..:||:.|:    ||:      |.
Human   503 LGARGLRVVVPHDVGL---TILKGAVLFGQAPGVVR----VRRSPLTYGV----GVL------NR 550

  Fly   419 TIPTKQ--------------TQIF-----------------TTYADNQPG---VLIQVF----EG 445
            .:|.:.              |.:|                 .:|...:||   |||.::    |.
Human   551 FVPGRHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPGQRRVLINLYCCAAED 615

  Fly   446 ERAMTRDN-NSLGKFELSAIPP--------APRGVPQVEVTFDIDANGILNVTALEKSTGKENRI 501
            .|.:|... ...|...|...|.        ||.|..::..........| .|||::.||.:..|.
Human   616 ARFITDPGVRKCGALSLELEPADCGQDTAGAPPGRREIRAAMQFGDTEI-KVTAVDVSTNRSVRA 679

  Fly   502 TI 503
            :|
Human   680 SI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-1NP_524063.1 PTZ00009 1..641 CDD:240227 134/652 (21%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 99/481 (21%)
HSPA12BNP_443202.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 12..53
NBD_sugar-kinase_HSP70_actin 61..529 CDD:327376 100/483 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.