DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and NXF3

DIOPT Version :9

Sequence 1:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_071335.1 Gene:NXF3 / 56000 HGNCID:8073 Length:531 Species:Homo sapiens


Alignment Length:457 Identity:88/457 - (19%)
Similarity:143/457 - (31%) Gaps:168/457 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 STPLTTNMRSHCY---------HNNNNNNKAGYTP------TLKG------RGDMNLSPIVGATP 394
            |.|:...|.|..:         |..:.::...|||      ..||      :..:|:.     ..
Human    34 SEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNME-----RE 93

  Fly   395 QKP-----TGTAP-GRLNNTFEPVAKTAPFN---GEKFVLDTMELLEQIEQPLDGTYNLQMSEQH 450
            |||     .|..| |.|.:.|:   .|.||.   .||::|:.:                      
Human    94 QKPPERRMEGNMPDGTLGSWFK---ITVPFGIKYNEKWLLNLI---------------------- 133

  Fly   451 RQMQCVMDLAEAEVEMLAQQGDEEQFENMLAEL---------------GKVNTLNEEQLKMQKSL 500
             |.:|.:.....|.          .:|||.|..               ||:...:.|::.:..:.
Human   134 -QNECSVPFVPVEF----------HYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNP 187

  Fly   501 DTIKRRFHRDEAEAEEREEELQQSAAEKVDTPVLNQSHSSSNSSGGGGERLLSRRSRLYDD-VNL 564
            ..|....||          ||:....|::.. .:||....|.      |.|..:|...|.| ||.
Human   188 AGIPHFVHR----------ELKSEKVEQIKL-AMNQQCDVSQ------EALDIQRLPFYPDMVNR 235

  Fly   565 SAMHGSNGSSTSTNSASFIVQRRDMPQVEQPAPDPDP----EPAEE-PPKSQV-TAEIDPASYKL 623
            .....||  .....:||..|...::|.| ..|.:.|.    ||.|: ..:|.| |...|.:|   
Human   236 DTKMASN--PRKCMAASLDVHEENIPTV-MSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSS--- 294

  Fly   624 PERRERDRDRFKTIKISKEMRLQPEIIVPCIDDE-------------------------PQQLED 663
                          .|:..:.|.|:::  |:|.:                         .:.|::
Human   295 --------------NINSILELFPKLL--CLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKN 343

  Fly   664 EQKQLVED--VRYEEDQRQGSPPGRLSRRDQTTAIS-----NNADASASNYLTYKKPKEKSLIQR 721
            ...|.::.  :.|:...||    |.||........|     |..|::.|::..:.|......|.:
Human   344 LVLQFLQQYYLIYDSGDRQ----GLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILK 404

  Fly   722 RP 723
            .|
Human   405 DP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021 12/53 (23%)
NXF3NP_071335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..59 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..106 5/27 (19%)
Tap-RNA_bind 110..192 CDD:312616 19/117 (16%)
noncanonical RNP-type RNA-binding (RBD) domain 115..192 17/112 (15%)
leucine-rich repeat (LRR) domains 193..329 37/174 (21%)
leucine-rich repeat 218..260 CDD:275382 12/49 (24%)
leucine-rich repeat 275..305 CDD:275382 9/46 (20%)
nuclear transport factor 2 (NTF2)-like domain 339..461 15/72 (21%)
NTF2 341..496 CDD:238403 15/70 (21%)
ubiquitin-associated domain 524..531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.