DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and Nxf7

DIOPT Version :9

Sequence 1:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_001032293.1 Gene:Nxf7 / 501621 RGDID:1566170 Length:614 Species:Rattus norvegicus


Alignment Length:280 Identity:47/280 - (16%)
Similarity:94/280 - (33%) Gaps:86/280 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PALQRTMILG------EEMIGDTTFNLVDSLTTSALQSESESLPVDG--NATFKRPTASATTADE 309
            |:::.|...|      ||.:.| ..::.......|.:.|.|....||  .:.||.........|:
  Rat    62 PSVRHTPYSGRRKSREEEHVED-QIHITVWRDEKAQKREVEQFTEDGTLESWFKVTIPCGRKCDK 125

  Fly   310 TQVLTGRQMNTTFTDGCNTPEGRCETP-----ENIDR-KLALLTMESSTPLTTNMRSHCYHNNNN 368
            ||::             |:....|..|     .:.|: ::.....:||  :...::...|..::.
  Rat   126 TQLM-------------NSVHSLCSVPFTPVDFHCDKYRIQFFVQDSS--IAYALKDVSYKISSE 175

  Fly   369 NNKAGYTPTLKGRGDMNLSPIVGATPQKPTGTAPGRLNNTFEPVAKTAPFNGEKFVLDTMELLEQ 433
                          |....||. ..|    ..||..:.|.|                 |.|.:||
  Rat   176 --------------DFEKIPIF-VNP----SVAPYSVQNRF-----------------TREQMEQ 204

  Fly   434 IEQPLDGTYNLQMSEQH----RQMQCVMDLAEAEVEMLAQQGD---------EEQFENMLAELGK 485
            ::..:...|::   .||    ::::...||....::|:..:..         :|.|..:|:    
  Rat   205 LKLAMKKRYDI---SQHALCLKKLRFDPDLMNHNIDMILNRRSCMTATLQIIQEDFPKLLS---- 262

  Fly   486 VNTLNEEQLKMQKSLDTIKR 505
            :|..:.:..::....|.:|:
  Rat   263 LNLSSNKLFQLDSLFDVVKK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021
Nxf7NP_001032293.1 Tap-RNA_bind 110..191 CDD:401194 17/114 (15%)
leucine-rich repeat 217..259 CDD:275382 7/41 (17%)
LRR_8 258..320 CDD:404697 4/29 (14%)
leucine-rich repeat 260..285 CDD:275382 4/27 (15%)
leucine-rich repeat 286..309 CDD:275382
leucine-rich repeat 310..340 CDD:275382
NTF2_like 380..531 CDD:415585
TAP_C 549..611 CDD:197882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.