DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and nxf4

DIOPT Version :10

Sequence 1:NP_648672.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster


Alignment Length:166 Identity:38/166 - (22%)
Similarity:67/166 - (40%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 NMLAELGKVNTLNEEQLKMQKSLD-TIKRRFHRDEAEAEE----REEELQQSAAEKVDTP----- 532
            |.:..|.....|.:....:::||| |:   |::|:|...|    .|.....:....||..     
  Fly   131 NSILRLHLTMVLLDRYDPVERSLDLTL---FYKDKALCGEFFALAESNCMSTVLGIVDREMPELE 192

  Fly   533 --VLNQSHSSSNSSGGGGERLLSRRSRLYDDVNLSAMHGSNGSSTSTNSASFIVQRRDMPQVEQP 595
              :|:.:|.::.......||   |..||:   ::|..|....:..|..:..|: ...::..::.|
  Fly   193 RLILDGNHLTNLWVFRKVER---RFPRLH---SISLKHNDIENIYSLRNLQFL-PLAELNLLDNP 250

  Fly   596 AP-DPDPEPAEEPPKSQVTAEI----DPASYKLPER 626
            .| ..:.|..:..|..||..:|    |||..:|.||
  Fly   251 LPAGYEKEVLDIWPSLQVLNKIQVTPDPAMMQLVER 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_648672.1 PHA03247 <676..965 CDD:223021
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 11/42 (26%)
PPP1R42 <191..276 CDD:455733 18/91 (20%)
leucine-rich repeat 191..216 CDD:275382 5/27 (19%)
leucine-rich repeat 217..240 CDD:275382 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.