DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and nxf2

DIOPT Version :9

Sequence 1:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster


Alignment Length:111 Identity:27/111 - (24%)
Similarity:37/111 - (33%) Gaps:39/111 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 DTPVLNQSHSSSNSSGGGGERLLSRRSR----LYDDVNL-------------SAMHGSNGSSTST 577
            :.|.....|.|....||    :|...||    .:|:.||             ..:|.:|.|.|:.
  Fly   706 EPPSTRNGHGSKTDIGG----VLLGFSRQFVVTFDEANLGLGKRARRLKIANERLHITNPSKTAI 766

  Fly   578 NSASFIVQRRDMPQVEQPAPDPDPEPAEEPPKSQVTAEIDPASYKL 623
            .:| |.|.          .|||....|||.       .:|...:||
  Fly   767 RNA-FSVN----------FPDPSERQAEED-------SLDVKDHKL 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382
leucine-rich repeat 475..500 CDD:275382
leucine-rich repeat 501..524 CDD:275382
leucine-rich repeat 525..555 CDD:275382
TAP_C 779..841 CDD:197882 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.