powered by:
Protein Alignment ssp2 and nxf1b
DIOPT Version :9
Sequence 1: | NP_001287065.1 |
Gene: | ssp2 / 39540 |
FlyBaseID: | FBgn0036389 |
Length: | 982 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001923961.1 |
Gene: | nxf1b / 323865 |
ZFINID: | ZDB-GENE-030131-2585 |
Length: | 642 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 28/69 - (40%) |
Gaps: | 11/69 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 526 AEKVDTPVLNQSHSSSNSSGGGGERLLSRRSRLYDDVNLSAMHGSNGSSTSTNSASFIVQRRDMP 590
::::..|.....||.....||||.. ..||||:|| :|..|.::......|||..|
Zfish 37 SDQMSRPRHRGGHSGGGGGGGGGGP--GPRSRLHDD---------DGDVTMSDIPQDSSQRRYNP 90
Fly 591 QVEQ 594
...|
Zfish 91 YGRQ 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3763 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.