DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ssp2 and nxf1b

DIOPT Version :9

Sequence 1:	NP_001287065.1	Gene:	ssp2 / 39540	FlyBaseID:	FBgn0036389	Length:	982	Species:	Drosophila melanogaster
Sequence 2:	XP_001923961.1	Gene:	nxf1b / 323865	ZFINID:	ZDB-GENE-030131-2585	Length:	642	Species:	Danio rerio

Alignment Length:	69	Identity:	20/69 - (28%)
Similarity:	28/69 - (40%)	Gaps:	11/69 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   526 AEKVDTPVLNQSHSSSNSSGGGGERLLSRRSRLYDDVNLSAMHGSNGSSTSTNSASFIVQRRDMP 590
            ::::..|.....||.....||||..  ..||||:||         :|..|.::......|||..|
Zfish    37 SDQMSRPRHRGGHSGGGGGGGGGGP--GPRSRLHDD---------DGDVTMSDIPQDSSQRRYNP 90

  Fly   591 QVEQ 594
            ...|
Zfish    91 YGRQ 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
ssp2	NP_001287065.1	PHA03247	<676..965	CDD:223021
nxf1b	XP_001923961.1	Tap-RNA_bind	138..219	CDD:286271
		leucine-rich repeat	246..288	CDD:275382
		LRR_8	287..349	CDD:290566
		LRR_4	287..333	CDD:289563
		leucine-rich repeat	289..314	CDD:275382
		leucine-rich repeat	315..338	CDD:275382
		leucine-rich repeat	339..369	CDD:275382
		NTF2_like	413..561	CDD:298832
		TAP_C	579..641	CDD:197882
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3763
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900