DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and Nxf3

DIOPT Version :9

Sequence 1:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_008771632.1 Gene:Nxf3 / 302591 RGDID:1564923 Length:571 Species:Rattus norvegicus


Alignment Length:328 Identity:65/328 - (19%)
Similarity:119/328 - (36%) Gaps:103/328 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 DTTFNLVDSLTTSALQSESESLPVDGNA---TFKRPTASATTADETQVLTGR--QMNTTFTDGCN 327
            ::|..:.|::.||....:.|.|.: .||   |.:|.|.....:...::...:  |||....:|..
  Rat    26 NSTEYISDTMRTSFYHQQDEELAM-SNAPMYTRRRYTPYGILSHHQRINLHKWDQMNVNMEEGAK 89

  Fly   328 TPEGRCE------TPEN-----------IDRK--LALLTMESSTPLT------TNMRSHCYHNNN 367
            .||.:.|      |.||           .|:|  |.|:..:.|.|.|      ..|::..:.:  
  Rat    90 PPERKMERDKQDDTSENWFKVTIPFGIKYDKKWMLNLIQSQCSIPFTPVQFHYEKMQATFFVD-- 152

  Fly   368 NNNKAGYTPTLKGRGDMNLSPIVGATPQKPTGTAPGRLNNTFEPV--------AKTAPFNGEKFV 424
                           |.|::.::.|...|.......:::....|.        .|:...:.:|..
  Rat   153 ---------------DPNIAFMLKAISDKIRDETDNKISIFISPCDEPHSVTELKSEKMDQKKLT 202

  Fly   425 L----DTME-LLEQ----IEQPLDGTY--NLQMSEQHRQMQCVMDLAEAEVEMLAQQG------- 471
            :    ||.: :|.:    .:|.|. ||  :|.:|.: |.|...::::|.:|.....:|       
  Rat   203 MNQQCDTSQRILNRQRLSFDQDLT-TYPTDLVLSPR-RYMTPSLNISEEDVTQANSEGKMAKEQA 265

  Fly   472 ------------------DEEQFENMLAEL-GKVNTLN-EEQLKM-------QKSLDTIKRRFHR 509
                              |:....|.:.|| .|:.:|: :|..|.       ||::.|.||.|..
  Rat   266 SDIEEICAVKSSLSTTMPDKSSNINSILELFPKLLSLDGQESCKPALCGPEDQKTISTYKRSFFE 330

  Fly   510 DEA 512
            .|:
  Rat   331 SES 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021
Nxf3XP_008771632.1 Tap-RNA_bind 104..186 CDD:286271 15/98 (15%)
leucine-rich repeat 211..250 CDD:275382 10/40 (25%)
leucine-rich repeat 269..298 CDD:275382 4/28 (14%)
NTF2_like 333..488 CDD:298832 0/1 (0%)
TAP_C 503..563 CDD:197882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.