DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssp2 and Nxf3

DIOPT Version :9

Sequence 1:NP_001287065.1 Gene:ssp2 / 39540 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_030107204.1 Gene:Nxf3 / 245610 MGIID:2685230 Length:567 Species:Mus musculus


Alignment Length:321 Identity:61/321 - (19%)
Similarity:105/321 - (32%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VTTNMHKSFLQD---TSPP-----------SSICSSMNTERMNNSLIT---------------SA 136
            |:..:|.||.|.   ::||           .|....::.::.|.:.:.               ..
Mouse    31 VSDTVHTSFYQQPAMSNPPMHTRRYTPYGIPSRYQRVSVQKWNQTDVNMEGGSKPPERKMQRDKQ 95

  Fly   137 DFTNLNFLQSTI--GLEQDPN-LTTTLTNQTT-------------------DNMGIGGSIGGYTL 179
            |.|:.|:.:.||  |::.|.. |...:.:|.:                   ||..|...:  ..:
Mouse    96 DDTSENWFKVTIPFGIKYDKKWLLNLIQSQCSIPFTPVQFHYEKMQAHFFVDNPNIAFML--KAI 158

  Fly   180 SDMI---RDRKALESLTMCEDDGTLIKDSHIGQIDEISLTLSKTASGCSTMDNSTDSMSIPLAAD 241
            ||.|   .|.|....::.| |:...:.:..:.::|...||   |...|:|.....:...:|...|
Mouse   159 SDKILDETDNKISIFISPC-DEPHSVTELKLEKMDHTMLT---TNQQCATSQRVLNRQRLPFDQD 219

  Fly   242 -RTMPVVVSAV-----CPALQRTMILGEEMIGDTTFNLVDSLTTSALQSESESLPVDGNATFKRP 300
             .|.|..::.|     .|:|.   |..|:|              :.:.||.|...|..      |
Mouse   220 LMTRPTDLALVPRRYMTPSLS---IHKEDM--------------TQVNSEGEVAKVHA------P 261

  Fly   301 TASATTADETQVLTGRQMNTTFTDGCNTPEGRCETPENIDRKLALLTMESSTPLTTNMRSH 361
            ......||::      .::||..|..:......|.   ..:.|:|...||..|.......|
Mouse   262 DLEKICADQS------SLSTTMPDKSSNINSILEL---FPKLLSLDGQESHKPTLCGPEDH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021
Nxf3XP_030107204.1 Tap-RNA_bind 99..181 CDD:370331 17/84 (20%)
leucine-rich repeat 206..244 CDD:275382 8/40 (20%)
leucine-rich repeat 263..293 CDD:275382 6/38 (16%)
NTF2_like 328..484 CDD:385413
TAP_C 499..561 CDD:197882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.