DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Meics and pad

DIOPT Version :9

Sequence 1:	NP_524062.1	Gene:	Meics / 39539	FlyBaseID:	FBgn0025874	Length:	583	Species:	Drosophila melanogaster
Sequence 2:	NP_650534.2	Gene:	pad / 41981	FlyBaseID:	FBgn0038418	Length:	924	Species:	Drosophila melanogaster

Alignment Length:	146	Identity:	50/146 - (34%)
Similarity:	68/146 - (46%)	Gaps:	34/146 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   414 CPDCDKSFFEKSNMMKHQRTHSGIKPFKCEE--CGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKG 476
            ||.|.:.|.:|.::.:|.:.|:|::||||.|  |.:.||...||..||..|:|:|.|.|:.|.|.
  Fly   710 CPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKP 774

  Fly   477 FSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFAL 541
            ||...:|.||...|                  ||.|             .:||:.|..|:..||.
  Fly   775 FSRKDNLNKHRRIH------------------TQTS-------------TETLYCCDVCNKNFAT 808

  Fly   542 KKTLDKHITSH-KIRP 556
            |...:||...| ||||
  Fly   809 KLHYEKHREMHKKIRP 824

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Meics	NP_524062.1	zf-AD	21..95	CDD:285071
		C2H2 Zn finger	242..262	CDD:275368
		C2H2 Zn finger	274..294	CDD:275368
		zf-H2C2_2	287..311	CDD:290200
		C2H2 Zn finger	302..322	CDD:275368
		C2H2 Zn finger	330..350	CDD:275368
		zf-H2C2_2	342..366	CDD:290200
		C2H2 Zn finger	358..378	CDD:275368
		C2H2 Zn finger	386..406	CDD:275368
		COG5048	<395..583	CDD:227381	50/146 (34%)
		zf-C2H2	412..434	CDD:278523	6/19 (32%)
		C2H2 Zn finger	414..434	CDD:275368	6/19 (32%)
		zf-H2C2_2	426..451	CDD:290200	10/26 (38%)
		C2H2 Zn finger	442..462	CDD:275368	9/21 (43%)
		zf-H2C2_2	454..478	CDD:290200	11/23 (48%)
		C2H2 Zn finger	470..486	CDD:275368	6/15 (40%)
		C2H2 Zn finger	500..520	CDD:275368	3/19 (16%)
		C2H2 Zn finger	532..552	CDD:275370	7/19 (37%)
		C2H2 Zn finger	559..579	CDD:275370
pad	NP_650534.2	zf-AD	16..87	CDD:214871
		C2H2 Zn finger	710..730	CDD:275368	6/19 (32%)
		zf-C2H2	736..760	CDD:278523	11/23 (48%)
		C2H2 Zn finger	738..760	CDD:275368	9/21 (43%)
		zf-H2C2_2	752..777	CDD:290200	12/24 (50%)
		zf-C2H2	766..788	CDD:278523	9/21 (43%)
		C2H2 Zn finger	768..788	CDD:275368	8/19 (42%)
		zf-H2C2_2	780..808	CDD:290200	12/58 (21%)
		C2H2 Zn finger	799..819	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24377
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100