DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meics and ZNF429

DIOPT Version :9

Sequence 1:NP_524062.1 Gene:Meics / 39539 FlyBaseID:FBgn0025874 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_016882237.1 Gene:ZNF429 / 353088 HGNCID:20817 Length:689 Species:Homo sapiens


Alignment Length:369 Identity:136/369 - (36%)
Similarity:200/369 - (54%) Gaps:39/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCP 306
            |.|||.::|......:|...|.|    :||:.|..||:.|..::.||:|:|.||||:|:||..|.
Human   302 CDECGKTFSISSTFTKHKIIHTE----EKPYKCKECGKAFNRSSTLTSHKRIHTGEKPYKCEECG 362

  Fly   307 KAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYK-------------- 357
            ||:....||..|...|..||.:||.:|.|.|.....|..|.:.||||.|||              
Human   363 KAFNWSSTLTKHKVIHTGEKPYKCEECGKAFNQSSRLTRHKKIHTGEEPYKFEKCGRVFTCSSTL 427

  Fly   358 --------------CPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNG 408
                          |.:|.:.|..:|.|..|.|:|.||:|:||..|||.|.::.||.:|.|:|.|
Human   428 TQDKKIHTGEKPYNCEECGKVFTYSSTLTRHKRIHTEEKPYKCNECGKAFNRSSHLTSHRRIHTG 492

  Fly   409 DRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQC 473
            ::.:||.:|.|:|.:.||:..|::.|||.||:||||||:||..:..|..|.:||||||||||::|
Human   493 EKPYKCEECGKAFKQSSNLNSHKKIHSGEKPYKCEECGKAFILSSRLTQHKKIHTGEKPYKCEEC 557

  Fly   474 GKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVR 538
            ||.|:.:..|.:|...|  ..::|:||.||.||:....:|..|:|.|.. ::|   ::|..|...
Human   558 GKAFNRSSRLTQHKKIH--TGEKPYKCKQCDKAFTHSSNLSSHKKIHSG-EKP---YKCEECGKA 616

  Fly   539 FALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLRLHNL 581
            |.....|.:|...| :.:|:.|.:|.:.|.....|.:|.::|.:
Human   617 FNRSSRLTQHKKIHTREKPYKCEECAKAFTRSSRLTQHKKIHRM 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MeicsNP_524062.1 zf-AD 21..95 CDD:285071
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
C2H2 Zn finger 274..294 CDD:275368 8/19 (42%)
zf-H2C2_2 287..311 CDD:290200 14/23 (61%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
zf-H2C2_2 342..366 CDD:290200 11/51 (22%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
COG5048 <395..583 CDD:227381 71/188 (38%)
zf-C2H2 412..434 CDD:278523 8/21 (38%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
zf-H2C2_2 426..451 CDD:290200 15/24 (63%)
C2H2 Zn finger 442..462 CDD:275368 9/19 (47%)
zf-H2C2_2 454..478 CDD:290200 15/23 (65%)
C2H2 Zn finger 470..486 CDD:275368 6/15 (40%)
C2H2 Zn finger 500..520 CDD:275368 8/19 (42%)
C2H2 Zn finger 532..552 CDD:275370 5/19 (26%)
C2H2 Zn finger 559..579 CDD:275370 5/19 (26%)
ZNF429XP_016882237.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3084
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.