DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meics and lin-29

DIOPT Version :9

Sequence 1:NP_524062.1 Gene:Meics / 39539 FlyBaseID:FBgn0025874 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_496545.1 Gene:lin-29 / 174830 WormBaseID:WBGene00003015 Length:459 Species:Caenorhabditis elegans


Alignment Length:200 Identity:73/200 - (36%)
Similarity:99/200 - (49%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 FAKNSGLKLH--SRLHK----EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFE 423
            |.:||.|..|  |:..:    |::|      ..|.:|.|..:...      :.:||..|.|:|..
 Worm   110 FHQNSLLPHHMFSQFGRYPQFEQKP------DVGVLQQQMQMREA------KPYKCTQCVKAFAN 162

  Fly   424 KSNMMKHQRTHSGIKPF-KCEECGQAFSHNHHLKSHLRIHTGEKPYKC--DQCGKGFSANQSLMK 485
            .|.:.:|.|.|.||||| .|..||:.|:...||:.|:|.|||||||||  ..|.|.||...:|..
 Worm   163 SSYLSQHMRIHLGIKPFGPCNYCGKKFTQLSHLQQHIRTHTGEKPYKCKFTGCDKAFSQLSNLQS 227

  Fly   486 HTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHIT 550
            |:..|  ..|:||||:.|.|.:..:|||..|...||.....| :|.||.|...:..:..|.||:|
 Worm   228 HSRCH--QTDKPFKCNSCYKCFTDEQSLLDHIPKHKESKHLK-IHICPFCGKSYTQQTYLQKHMT 289

  Fly   551 SHKIR 555
            .|..|
 Worm   290 KHADR 294

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MeicsNP_524062.1 zf-AD 21..95 CDD:285071
C2H2 Zn finger 242..262 CDD:275368
C2H2 Zn finger 274..294 CDD:275368
zf-H2C2_2 287..311 CDD:290200
C2H2 Zn finger 302..322 CDD:275368
C2H2 Zn finger 330..350 CDD:275368