DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32137 and Spdl1

DIOPT Version :9

Sequence 1:NP_729935.1 Gene:CG32137 / 39537 FlyBaseID:FBgn0052137 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_081687.2 Gene:Spdl1 / 70385 MGIID:1917635 Length:608 Species:Mus musculus


Alignment Length:498 Identity:111/498 - (22%)
Similarity:211/498 - (42%) Gaps:100/498 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QLQQKESDILLAAELGKALLEKNEELVKQQEKLIEDYSSKIEKLEQEKHVLRQKLAIAEDESDQR 173
            :|::.|.:.|.||..|..|||:..||..|.:|..|:.....||..||||.|::::.:.....|..
Mouse    11 KLKECEDERLKAAHYGLQLLERQTELQSQLDKCHEEMMITAEKYNQEKHALQREVELKSRMLDSL 75

  Fly   174 VLELQSDLTELKDKLQTQDTAIRQAEKEKTILIDELQHQNTRLTEQIQEAHATELKLSAQIQELK 238
            ..|.::...:.|.:|:..:..:.::.:::   :.:|:::...|..::.||...|.:|..::....
Mouse    76 SCECEALKQQQKAQLEQLEVQLHRSHRQE---VSDLKNKLENLKVELDEARLGEKQLKQKLDLQG 137

  Fly   239 DQYHYRNSSL-----QEHVNSLES----IKTELNLTTGKRQELE---RRLQIAQEEKESLTSSLE 291
            :...:::..|     |..::|:.|    ::|||....|.:..|:   ..||..||:.|.|.:||.
Mouse   138 ELLAHKSEELRLLSEQRVLSSMSSELLALETELTAAEGVKNALKEEVNELQYKQEQLECLNTSLL 202

  Fly   292 ESSDRIHMLERHAREQETKLETTLQALERSQRENNVLSERLG------ADTNSSTPGRKSLQFEM 350
            ...||   |:....|:|.:..:...|||:::.||..|..:||      ||.||            
Mouse   203 HQVDR---LKEEKEEREREAVSYYNALEKARVENQDLQVQLGHALQQAADPNS------------ 252

  Fly   351 ECDEDDGSYTETGKPNQMFVEARSVYIQLKSLVDSLKVSHDDDSGLNSDISLELESMDNTISSSE 415
                         |.|.:|.|.....:.::..::.:|..:......|:....::..|...||:..
Mouse   253 -------------KGNSLFAEVEDRRVAMERQLNLMKDKYQSLKKQNAFTRDQMNKMKLQISTLL 304

  Fly   416 RHEDGHLAIEFRQ-----GMLSSMSDELTRLLLNLDAGNFKKMLDQTRNLVLEQEDEIKRSHQLI 475
            |.....  .||.|     .|:...:.|:..||     |...| |::.:|              |.
Mouse   305 RMRGSQ--TEFEQQERLFAMIEQKNGEIKHLL-----GEINK-LEKFKN--------------LY 347

  Fly   476 QQLEAKVTVTDVELQNVKEERDQARGDLEDNTDRDELLSKAQTERDAANDRRTKAEVELAKTRVE 540
            :.:|::.:.:|....            |||:|...:||   |.:.|..|......:.||:   ::
Mouse   348 ESMESRPSTSDTACV------------LEDSTYYSDLL---QLKLDKLNKENESTKDELS---IQ 394

  Fly   541 LMQANSQLLESIQQKVELSQQL--EQWQMDMHELIDEQMRSKL 581
            .|:|   |.|| |:.:::.::|  .:..:.:.|..:.::|:||
Mouse   395 RMKA---LFES-QRALDIERKLFTNERHLQLSESENMKLRAKL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32137NP_729935.1 DUF4337 <105..>172 CDD:290935 21/62 (34%)
Spdl1NP_081687.2 Smc <1..344 CDD:224117 85/371 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32123
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.