DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32137 and Myo18a

DIOPT Version :9

Sequence 1:NP_729935.1 Gene:CG32137 / 39537 FlyBaseID:FBgn0052137 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_036012684.1 Gene:Myo18a / 360013 MGIID:2667185 Length:2493 Species:Mus musculus


Alignment Length:627 Identity:137/627 - (21%)
Similarity:243/627 - (38%) Gaps:212/627 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LEKNEELVKQQEKLIEDYSSKIEKLEQEKHVLRQKLAIAEDESDQRVLELQSDLT------ELKD 186
            ::.:||.::.:::.|:...||:||:|:|::.||    ::.|..:.|:.||.|:||      |...
Mouse  1300 VQLSEEQIRNKDEEIQQLRSKLEKVEKERNELR----LSSDRLETRISELTSELTDERNTGESAS 1360

  Fly   187 KLQTQDTAIR-QAEKEKTILIDELQHQNTRLTEQ--IQEAHATELKL--SAQI------------ 234
            :|...:||.| :.|||    :.|||.|...|.:|  :.|....|.:|  :|:|            
Mouse  1361 QLLDAETAERLRTEKE----MKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGE 1421

  Fly   235 --------------------QELKDQYHYRNSSLQEHVNSLESIKTELNLTTGKRQELERRLQIA 279
                                |||:|:......|.::....|..::.:.:.:....|:|:::.|..
Mouse  1422 WRLKYERAVREVDFTKKRLQQELEDKMEVEQQSRRQLERRLGDLQADSDESQRALQQLKKKCQRL 1486

  Fly   280 QEEKESLTSSLEESSDRIHMLERHAREQETKL-----ETTLQALERS--QRENNVL--------- 328
            ..|.:.....||....|.|.||:..|..:::|     ||..:.|:|.  |||.::|         
Mouse  1487 TAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEETQREKLQREKLQREKDMLLAEAFSLKQ 1551

  Fly   329 --------------------------SERLGADTNSSTPGRKSLQ--------FEMECDEDDGSY 359
                                      |.:...|..|....:|.|:        .|.|.||..||.
Mouse  1552 QMEEKDLDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGSI 1616

  Fly   360 TETGKPNQMFVEARSVYIQLKSLVDSLKVSHDDDSGLNSDISLELESMDNTISSS---------- 414
                   ||..:|:   ::|:..::.::.:|          |.|:||.|..:..:          
Mouse  1617 -------QMLEQAK---LRLEMEMERMRQTH----------SKEMESRDEEVEEARQSCQKKLKQ 1661

  Fly   415 ------ERHEDGHLAIEFR---QGMLSSMSDEL-----------------TRLLLNLDAGNFKKM 453
                  |.:||...|:..:   :..||::||::                 |:.|| .||   :.|
Mouse  1662 MEVQLEEEYEDKQKALREKRELESKLSTLSDQVNQRDFESEKRLRKDLKRTKALL-ADA---QIM 1722

  Fly   454 LDQTRNLV------------LEQ---------------EDEIKRSHQLIQQLEAKVTVTDVELQN 491
            ||..:|..            ||:               |.|::..|..|..:....|..:.:|..
Mouse  1723 LDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEMEDLHLQIDDIAKAKTALEEQLSR 1787

  Fly   492 VKEERDQARGDL-EDNTDRDELLSK-----AQTERDAANDRRTKAEVELAKTRVELMQANSQLLE 550
            ::.|:::.:..| ||..|.:||:.|     ||..||.|.....:|::|                |
Mouse  1788 LQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQIE----------------E 1836

  Fly   551 SIQQKVELSQQLEQWQMDMHELIDEQMRSK-LINNRRAMAAE 591
            |.::|.||.::|:..|..: |.:::.|..| |::.:.|...|
Mouse  1837 SNKEKQELQEKLQALQSQV-EFLEQSMVDKSLVSRQEAKIRE 1877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32137NP_729935.1 DUF4337 <105..>172 CDD:290935 12/43 (28%)
Myo18aXP_036012684.1 PDZ_signaling 220..308 CDD:238492
COG5022 429..1950 CDD:227355 137/627 (22%)
MYSc_Myo18 467..1224 CDD:276837
MDN1 <1782..2121 CDD:227596 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.