DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32137 and rsad1

DIOPT Version :9

Sequence 1:NP_729935.1 Gene:CG32137 / 39537 FlyBaseID:FBgn0052137 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_002939612.3 Gene:rsad1 / 100495700 XenbaseID:XB-GENE-6045883 Length:438 Species:Xenopus tropicalis


Alignment Length:274 Identity:57/274 - (20%)
Similarity:104/274 - (37%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 SSTPGRKSLQFEMECDEDDGS-YTETGKPNQMFVEARSVYIQLKSLVDSLKVSHDDDSGLNSDIS 401
            ||..||:|:  ...|.|::.: |.     :..:.|.|..|......:.    ..|:::.:.|.:.
 Frog    22 SSRQGRESV--AKPCSEEEAALYV-----HWPYCEKRCTYCNFNKYIP----RSDNEAAIRSCLV 75

  Fly   402 LELESMDNTISSSERHEDGHLAIEFRQGMLSSMSDELTRLLLNLDAGNFKKMLDQTRNLVLEQED 466
            .|..::   |..|:.|   .:...|..|...|::...| :...|:|.:...:|.|...:.||...
 Frog    76 QEARTL---IRLSQVH---RITSVFFGGGTPSLASHGT-IAAVLEAVSQTALLPQDAEITLEANP 133

  Fly   467 EIKRSHQLIQQLEAKVTVTDVELQNVKEERDQARGDLEDNTDRDELLSKAQ-TERDAAN--DRRT 528
            ......:|.|..:|.|....|.:|::.::.....|       |....|:|| |..:|.|  ..||
 Frog   134 TSAERSRLQQFQKAGVNRLSVGVQSLDDQELLLLG-------RTHSTSEAQKTLEEACNLFPGRT 191

  Fly   529 KAEV-------ELAKTRVELMQANSQLLESIQQKVELSQQLEQWQMDMHELI--------DEQMR 578
            ..::       .||.....|    .|||:.....|.|.|...:....:.:::        |.::.
 Frog   192 SVDIIFGLPGQSLASWHRTL----RQLLDICDDHVSLYQLTLERGTSLFKMVQDGRLSTPDMEVA 252

  Fly   579 SKLINNRRAMAAES 592
            |::..:.|...:||
 Frog   253 SQMYEDARRTLSES 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32137NP_729935.1 DUF4337 <105..>172 CDD:290935
rsad1XP_002939612.3 PRK09057 40..414 CDD:181629 50/254 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165176124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.