powered by:
Protein Alignment CG32137 and nat8.5
DIOPT Version :9
Sequence 1: | NP_729935.1 |
Gene: | CG32137 / 39537 |
FlyBaseID: | FBgn0052137 |
Length: | 620 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004911368.1 |
Gene: | nat8.5 / 100489520 |
XenbaseID: | XB-GENE-6464258 |
Length: | 219 |
Species: | Xenopus tropicalis |
Alignment Length: | 53 |
Identity: | 12/53 - (22%) |
Similarity: | 20/53 - (37%) |
Gaps: | 6/53 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 306 EQETKLETTLQALERSQRENNVLSERLGADTNSSTPG------RKSLQFEMEC 352
|.|.|:...:.|....:.|:.::..||....|....| .|.:.|..:|
Frog 113 ESEGKVVGMVAAQPSEESEDEMVLRRLSVGRNHRMKGIAKVLCVKVIDFAGQC 165
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32137 | NP_729935.1 |
DUF4337 |
<105..>172 |
CDD:290935 |
|
nat8.5 | XP_004911368.1 |
Acetyltransf_1 |
75..190 |
CDD:366181 |
12/53 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2BWXB |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR32123 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4483 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.900 |
|
Return to query results.
Submit another query.