DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32137 and nat8.5

DIOPT Version :9

Sequence 1:NP_729935.1 Gene:CG32137 / 39537 FlyBaseID:FBgn0052137 Length:620 Species:Drosophila melanogaster
Sequence 2:XP_004911368.1 Gene:nat8.5 / 100489520 XenbaseID:XB-GENE-6464258 Length:219 Species:Xenopus tropicalis


Alignment Length:53 Identity:12/53 - (22%)
Similarity:20/53 - (37%) Gaps:6/53 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EQETKLETTLQALERSQRENNVLSERLGADTNSSTPG------RKSLQFEMEC 352
            |.|.|:...:.|....:.|:.::..||....|....|      .|.:.|..:|
 Frog   113 ESEGKVVGMVAAQPSEESEDEMVLRRLSVGRNHRMKGIAKVLCVKVIDFAGQC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32137NP_729935.1 DUF4337 <105..>172 CDD:290935
nat8.5XP_004911368.1 Acetyltransf_1 75..190 CDD:366181 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR32123
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.