DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and BIK1

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_009901.1 Gene:BIK1 / 850328 SGDID:S000000534 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:501 Identity:116/501 - (23%)
Similarity:188/501 - (37%) Gaps:121/501 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKNLKVGARVEL--TGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCD-E 62
            |.....|:|..:::  .|:   |.:.|||......|.:.||.|....|||.||..|::|||.: .
Yeast     1 MDRYQRKIGCFIQIPNLGR---GQLKYVGPVDTKAGMFAGVDLLANIGKNDGSFMGKKYFQTEYP 62

  Fly    63 NCGMFVRPTQL-RLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLT 126
            ..|:|::..:: .|:|.|..|:                |..|.:....|:..:|     |..:||
Yeast    63 QSGLFIQLQKVASLIEKASISQ----------------TSRRTTMEPLSIPKNR-----SIVRLT 106

  Fly   127 TSLSERTASSSSIGPRKSL-------APQNSKDKESPSTSLAEGAPAASGGNGAASHASSKRASF 184
            ...|......|.. |.:|.       ..|.|.|:|            ||..:.........|...
Yeast   107 NQFSPMDDPKSPT-PMRSFRITSRHSGNQQSMDQE------------ASDHHQQQEFGYDNREDR 158

  Fly   185 VETGFLEILKPQFTPSQPLRSPSFTMPSNSGAEDKVALLEAQKTSAEL-QAQLADLTEKLETLKQ 248
            :|..  .||......:.  .:.|...|.|....|    |.:.:.:.|| :|||.  .|||    |
Yeast   159 MEVD--SILSSDRKANH--NTTSDWKPDNGHMND----LNSSEVTIELREAQLT--IEKL----Q 209

  Fly   249 RRNEDKERLREFDKMKIQFEQLQEFRTKIMGAQASLQKELLRAKQEAKDAIEAKEQHAQEMADLA 313
            |:....:||  .|..::..|::|....:........:||:...||:.:  :|.::|..|:....|
Yeast   210 RKQLHYKRL--LDDQRMVLEEVQPTFDRYEATIQEREKEIDHLKQQLE--LERRQQAKQKQFFDA 270

  Fly   314 DNVEMITLDKEMAEEKADTLQLELE-----SSKERIEELEVDLELLRS-EMQ---NKAESAIGNI 369
            :|.:::.:..::.||..:..:..|.     .:.|.:|.|:..||.||: |.|   :|.:.|    
Yeast   271 ENEQLLAVVSQLHEEIKENEERNLSHNQPTGANEDVELLKKQLEQLRNIEDQFELHKTKWA---- 331

  Fly   370 SGGGDSPGLSTYEFKQLEQQNIRLKETLVRLRDLSAHDKHDIQKLSKEL------EMKRSEVTEL 428
                       .|.:||:..|..|.:              :.|.|||||      :....||..|
Yeast   332 -----------KEREQLKMHNDSLSK--------------EYQNLSKELFLTKPQDSSSEEVASL 371

  Fly   429 ERTKEKLSAKIDELEAIVA----------DLQEQVDAALGAEEMVE 464
            .:..|:.:.||.:||...|          |....||...|.::..|
Yeast   372 TKKLEEANEKIKQLEQAQAQTAVESLPIFDPPAPVDTTAGRQQWCE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 21/69 (30%)
Dynactin 553..834 CDD:289240
BIK1NP_009901.1 CAP_GLY 8..73 CDD:396049 21/67 (31%)
SMC_prok_B 193..>395 CDD:274008 58/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18916
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1398
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.