DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and CLIP4

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001274456.1 Gene:CLIP4 / 79745 HGNCID:26108 Length:705 Species:Homo sapiens


Alignment Length:429 Identity:106/429 - (24%)
Similarity:159/429 - (37%) Gaps:132/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
            ::...||:|.||.:.|:. :||:.:.|.|.||.|:|.|:.||||:|||:||:...|||:|....|
Human   278 LTSLGLKLGDRVVIAGQK-VGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYG 341

  Fly    66 MFVRPTQLRLLEAAPGSRRSIEDVSGATPT--AAQP----------------TKARLSSSRTSLS 112
            :|   ..|..:..|.|.|::|..    ||:  ||.|                ....::|.:.|.|
Human   342 IF---APLSKISKAKGRRKNITH----TPSTKAAVPLIRSQKIDVAHVTSKVNTGLMTSKKDSAS 399

  Fly   113 SSRQSL-----LGSRTQLTTSLSERTASSSSIG--------PRKSLAPQNSKDKESPSTSLAEGA 164
            .|..||     |.:.|:...:|....:|.||..        |:|..|..::|...|.|.||:..|
Human   400 ESTLSLPPGEELKTVTEKDVALLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRA 464

  Fly   165 PAASGGNGAASHASSKRAS---------------------FVETGF-------LEILKP------ 195
             :|...:.|.|.|::.|..                     |..|.|       :|:.||      
Human   465 -SAGLNSSATSTANNSRCEGELRLGERVLVVGQRLGTIRFFGTTNFAPGYWYGIELEKPHGKNDG 528

  Fly   196 -----QFTPSQPLRSPSFTMPSNSGAEDKVALLEAQKTSAELQAQLADLTEKLETLKQRRNEDKE 255
                 |:....| |...|..||                      ::..:|:.|:||.        
Human   529 SVGGVQYFSCSP-RYGIFAPPS----------------------RVQRVTDSLDTLS-------- 562

  Fly   256 RLREFDKMKIQFEQLQEFRTKIMGAQASLQKELLR--AKQEAKDAIEAKEQHAQEMADLADNVE- 317
               |....| |......||.......||.|||:.|  |..::|.|:............:..:|: 
Human   563 ---EISSNK-QNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKL 623

  Fly   318 ------MITLDKEMAEEK---------ADTLQLELESSK 341
                  ::|...||...:         ...|.|||.|:|
Human   624 HEGSQVLLTSSNEMGTVRYVGPTDFASGIWLGLELRSAK 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 28/65 (43%)
Dynactin 553..834 CDD:289240
CLIP4NP_001274456.1 ANK 1 65..101
ANK 98..252 CDD:238125
ANK repeat 109..146 CDD:293786
ANK 2 149..180
ANK repeat 153..184 CDD:293786
ANK repeat 186..217 CDD:293786
ANK 3 186..215
CAP_GLY 285..349 CDD:307465 29/67 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..479 13/48 (27%)
CAP_GLY 487..551 CDD:307465 12/86 (14%)
CAP_GLY 626..690 CDD:307465 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.