DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and Clip3

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001074583.1 Gene:Clip3 / 76686 MGIID:1923936 Length:547 Species:Mus musculus


Alignment Length:153 Identity:48/153 - (31%)
Similarity:78/153 - (50%) Gaps:19/153 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
            :|...|::|.||.|.|:. .||:.:.|.|.||.|:||||.||||:|||.||:.|.:||.|....|
Mouse   289 LSALGLRLGDRVLLDGQK-TGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQG 352

  Fly    66 MFVRPTQL-RLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTT-- 127
            :|...::: :.::|.|.|            ..:.|...|:..||.: ...|:...|.:...::  
Mouse   353 LFASVSKVSKAVDAPPSS------------VTSTPRTPRMDFSRVT-GKGRREHKGKKKSPSSPS 404

  Fly   128 --SLSERTASSSSIGPRKSLAPQ 148
              ||.:|..:.:.:|.:..:|.|
Mouse   405 LGSLQQREGAKAEVGDQVLVAGQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 31/66 (47%)
Dynactin 553..834 CDD:289240
Clip3NP_001074583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
ANK 1 117..158
ANK repeat 120..157 CDD:293786
Ank_2 122..228 CDD:403870
ANK repeat 159..190 CDD:293786
ANK 2 160..191
ANK 3 197..229
ANK repeat 198..228 CDD:293786
CAP_GLY 296..360 CDD:396049 31/64 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..413 12/60 (20%)
CAP_GLY 418..482 CDD:396049 3/10 (30%)
GoLD 488..547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1398
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.