powered by:
Protein Alignment DCTN1-p150 and Tbcb
DIOPT Version :9
Sequence 1: | NP_524061.1 |
Gene: | DCTN1-p150 / 39536 |
FlyBaseID: | FBgn0001108 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079824.2 |
Gene: | Tbcb / 66411 |
MGIID: | 1913661 |
Length: | 244 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 34/69 - (49%) |
Similarity: | 44/69 - (63%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LKVGARVELTGKD---LLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGMF 67
:.||:|.|:...| ..|||.|||:|.|..|.||||..|||.|||.||:.|::||:|....|.|
Mouse 159 ISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAF 223
Fly 68 VRPT 71
|:|:
Mouse 224 VKPS 227
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1550378at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.