DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and clip3

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_005157797.1 Gene:clip3 / 562450 ZFINID:ZDB-GENE-131127-193 Length:539 Species:Danio rerio


Alignment Length:158 Identity:49/158 - (31%)
Similarity:71/158 - (44%) Gaps:35/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
            :|...||:|.||.| .:...||:.:.|.|.||.|:|||:.||||:|||.||:.|.:||.|....|
Zfish   277 LSSLGLKLGDRVVL-DETKTGTLRFCGTTEFASGQWVGLELDEPEGKNDGSVGGIRYFICSAKQG 340

  Fly    66 MFVRPTQL-RLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTTSL 129
            :|...::: :.:|..|.|            ..:.|...|:..||.:....::.....|       
Zfish   341 IFAPVSKITKAVEQTPSS------------VTSTPKTPRMDLSRVTGKIKKEKKEKDR------- 386

  Fly   130 SERTASSSSIGPRK------SLAPQNSK 151
             |:|       |||      ||.|...|
Zfish   387 -EKT-------PRKKSLSGVSLDPDGVK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 29/66 (44%)
Dynactin 553..834 CDD:289240
clip3XP_005157797.1 ANK 100..222 CDD:238125
ANK repeat 108..145 CDD:293786
Ank_2 110..216 CDD:289560
ANK repeat 147..178 CDD:293786
ANK repeat 186..216 CDD:293786
CAP_GLY 285..348 CDD:279625 29/63 (46%)
CAP_GLY 410..473 CDD:279625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.