DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and Tbcb

DIOPT Version :10

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_611425.1 Gene:Tbcb / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster


Alignment Length:76 Identity:29/76 - (38%)
Similarity:39/76 - (51%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VGARVELT---GKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGMFVR 69
            :|.|.|:|   .....||:.|.|......|.::||..|||.|||:||..|:.||.|..|.|.||.
  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224

  Fly    70 PTQLRLLEAAP 80
            |..:.:.:..|
  Fly   225 PLSVTVGDFPP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..73 CDD:460154 28/67 (42%)
NIP100 13..>272 CDD:227569 27/71 (38%)
SMC_prok_B <219..>497 CDD:274008
Dynactin 550..834 CDD:463591
Smc <965..>1080 CDD:440809
TbcbNP_611425.1 Ubiquitin_2 13..93 CDD:405277
CAP_GLY 160..225 CDD:460154 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.