DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and Ccdc187

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_808509.1 Gene:Ccdc187 / 329366 MGIID:3045295 Length:958 Species:Mus musculus


Alignment Length:433 Identity:93/433 - (21%)
Similarity:148/433 - (34%) Gaps:120/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KGKNS-----GSIKGQQYFQCDENCGMFVRPTQLRLLEAAPGSRRSI----EDVSGATPTAAQPT 100
            :||||     |::..||:           |...|...|:.|  ||:.    :|.|...| .:.|.
Mouse   392 EGKNSSLHRAGNLHSQQH-----------RKKALAEHESCP--RRTWTGQGQDSSFPRP-GSTPE 442

  Fly   101 KARLSSSRTSLSSSRQSLLGSRTQLTTSLSERT--ASSSSIGPRKSLAPQNSKDKESPSTSLAEG 163
            |.|..|.|...:.:||           :..:||  |....|..:||   .:|..|.||.:.....
Mouse   443 KPRFFSQRPWSALARQ-----------TYPQRTWDAQGQDISVQKS---GSSLKKPSPFSQRPWS 493

  Fly   164 APAASGGNGAASHASSKRASFVETGFLEILKPQFTPSQPLRSPSFTMPSNSGAEDKVALLEAQKT 228
            |.|     |.|..|...|..|..:.:..:.:|......|. |.||...|:..::.|.|:....|.
Mouse   494 ALA-----GRAYSACEDREVFEPSPWNSLSRPHSALQDPW-SNSFVQRSSPSSKGKSAVPPPSKV 552

  Fly   229 SAELQAQLADLTEKLETLKQ-----------RRNEDKERLREFDKMKIQFEQLQEFRTKIMGAQA 282
            .........||.:.....:|           .:....|.||:|.:.|.|..:.|....|.:.|. 
Mouse   553 KPAWPEPSQDLLQSKPAKEQDTPCPRPRGSLGQQHSSESLRDFMRQKAQARRQQALEQKALAAH- 616

  Fly   283 SLQKELLRAKQEAKDAIEAKEQHAQEMADLADNVEMITLDKEMAEEKADTLQLELESSKERIEEL 347
                           .:|.:.|..||:                             ..|:|...|
Mouse   617 ---------------TLELRNQRLQEV-----------------------------YRKQREAVL 637

  Fly   348 EVDLELLRSEMQNKAESAIGNISGGGDSPG-LSTYEFKQLEQQNIRLKETLVRLRDLSAHD---- 407
            ..|:.:: |:.:....:.:...|||.::|| |.:    ..||...::...:| |.|..|.|    
Mouse   638 GKDIPVV-SQRRPGIVTFVPMQSGGMEAPGSLGS----PREQTWSKVTSGMV-LGDQEAPDSFCL 696

  Fly   408 -------KHDIQKLSKELE-MKRSEVTELERTKEKLSAKIDEL 442
                   :.:.|...:.|| .|::.:..||...|.|..::|.|
Mouse   697 CLNKPWNRIETQDTGRPLEGYKQARLQALETMAEALRQRVDIL 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 8/33 (24%)
Dynactin 553..834 CDD:289240
Ccdc187NP_808509.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 345..447 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..492 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..602 17/92 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 916..958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.