Sequence 1: | NP_524061.1 | Gene: | DCTN1-p150 / 39536 | FlyBaseID: | FBgn0001108 | Length: | 1265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186499.1 | Gene: | CLIP3 / 25999 | HGNCID: | 24314 | Length: | 547 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 71/268 - (26%) |
---|---|---|---|
Similarity: | 111/268 - (41%) | Gaps: | 70/268 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
Fly 66 MFVRPTQL-RLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTT-- 127
Fly 128 -SLSERTASSSSIGPRKSLAPQN-------SKDKESPS----------TSLAEG----------- 163
Fly 164 ------APAAS----GGNGAASHASSKRASFVETGFLEILKPQFTPSQPLRSPSFT---MPSNSG 215
Fly 216 AEDKVALL 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DCTN1-p150 | NP_524061.1 | CAP_GLY | 8..74 | CDD:214997 | 31/66 (47%) |
Dynactin | 553..834 | CDD:289240 | |||
CLIP3 | NP_001186499.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..49 | ||
ANK 1 | 117..158 | ||||
ANK repeat | 120..157 | CDD:293786 | |||
Ank_2 | 122..228 | CDD:372319 | |||
ANK repeat | 159..190 | CDD:293786 | |||
ANK 2 | 160..191 | ||||
ANK 3 | 197..229 | ||||
ANK repeat | 198..228 | CDD:293786 | |||
CAP_GLY | 296..360 | CDD:366568 | 31/64 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 365..413 | 12/59 (20%) | |||
CAP_GLY | 418..482 | CDD:366568 | 10/63 (16%) | ||
GoLD | 488..547 | 14/56 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5244 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1398 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |