DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and clip3

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001120145.1 Gene:clip3 / 100145183 XenbaseID:XB-GENE-5806327 Length:534 Species:Xenopus tropicalis


Alignment Length:148 Identity:43/148 - (29%)
Similarity:69/148 - (46%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEKNLKVGARVELTGKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCG 65
            ::...:|:|.|: |...:..||:.:.|.|.||.|:||||.||||:|||.||:.|.:||.|....|
 Frog   279 LASLGMKLGDRI-LLDAEKAGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGIRYFICPPKQG 342

  Fly    66 MFVRPTQLRLLEAAPGSRRSIEDVSGATPTAAQPTKARLSSSRTSLSSSRQSLLGSRTQLTTSLS 130
            :|           ||.|:.|.......:...:.|...|:..||.:....::.....:..|:....
 Frog   343 IF-----------APVSKISKAPDQPPSSVTSTPRTPRVDFSRVTGKGRKEKKATHKKSLSVGSL 396

  Fly   131 ERTASSSSIGPRKSLAPQ 148
            ::......||.:..:|.|
 Frog   397 DKEGLKIDIGDQVLVAGQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 29/65 (45%)
Dynactin 553..834 CDD:289240
clip3NP_001120145.1 ANK repeat 110..147 CDD:293786
Ank_2 112..218 CDD:372319
ANK repeat 149..185 CDD:293786
ANK repeat 187..218 CDD:293786
CAP_GLY 286..350 CDD:366568 32/75 (43%)
CAP_GLY 405..469 CDD:366568 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1398
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.