DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN1-p150 and tbcb

DIOPT Version :9

Sequence 1:NP_524061.1 Gene:DCTN1-p150 / 39536 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_002932660.1 Gene:tbcb / 100038107 XenbaseID:XB-GENE-489743 Length:246 Species:Xenopus tropicalis


Alignment Length:84 Identity:36/84 - (42%)
Similarity:47/84 - (55%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEKNLKV------------GAR--VELTGKDL-LGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGS 51
            :|:|.|:            |||  |.:.|:.. .|||.|||:..|..|.||||..|||.|||.||
 Frog   144 AEQNRKLEEERLVAESITHGARCEVRVAGQPTKRGTVMYVGLADFKPGYWVGVKYDEPLGKNDGS 208

  Fly    52 IKGQQYFQCDENCGMFVRP 70
            ::|::||.|....|.||:|
 Frog   209 VEGKRYFTCTPKYGAFVKP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 33/78 (42%)
Dynactin 553..834 CDD:289240
tbcbXP_002932660.1 Ubl_TBCB 12..90 CDD:340487
CAP_GLY 169..230 CDD:366568 29/59 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1550378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.