DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and SLC9A3R1

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_004243.1 Gene:SLC9A3R1 / 9368 HGNCID:11075 Length:358 Species:Homo sapiens


Alignment Length:261 Identity:71/261 - (27%)
Similarity:102/261 - (39%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 HGFGICVKGGKDSGLGVYISRIEENSVAERAGLRPGDTILEVNGTPFTSINHEEALKRCVQILKS 371
            :|:|..:.|.|.. ||.||..:|..|.||:|||..||.::||||.......|::.:.|....|.:
Human    22 NGYGFHLHGEKGK-LGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNA 85

  Fly   372 SRQISMTVRAPPTLNSTAPLHGFGPPSRDPMYASMAPPLHPQNQAAAAAAAAAASGAGLPFRQTC 436
            .|   :.|..|.|   ...|...|...|:.:..:...|     ..|...|||...|||       
Human    86 VR---LLVVDPET---DEQLQKLGVQVREELLRAQEAP-----GQAEPPAAAEVQGAG------- 132

  Fly   437 SWMDRHGRPASPPMEYGGRRSERRDRIRRVELLIEPGQSLGLMIRGGVEYGL---------GIFV 492
                    ..:.|.|......|:|:        :.|  .|..|.:|...||.         |.|:
Human   133 --------NENEPREADKSHPEQRE--------LRP--RLCTMKKGPSGYGFNLHSDKSKPGQFI 179

  Fly   493 TGVDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQLKY---HKRMSLVIRDVGKVPHSCTS 554
            ..||.||.|:.|||...|.|:||||.......|.:.|..::.   ..::.:|.|:..:....|..
Human   180 RSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRV 244

  Fly   555 I 555
            |
Human   245 I 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 25/72 (35%)
PDZ_signaling 466..543 CDD:238492 25/88 (28%)
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
SLC9A3R1NP_004243.1 PDZ_signaling 12..91 CDD:238492 25/72 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..192 25/107 (23%)
PDZ_signaling 152..231 CDD:238492 24/80 (30%)
EBP50_C 235..358 CDD:312529 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.