Sequence 1: | NP_001261810.1 | Gene: | dysc / 39533 | FlyBaseID: | FBgn0264006 | Length: | 1254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065132.1 | Gene: | GOPC / 57120 | HGNCID: | 17643 | Length: | 462 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 50/205 - (24%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 56/205 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 360 EALKRCVQILKSS-------------------RQISMTVRAPPTLNSTAPLHGFGPPSRDPMYAS 405
Fly 406 MAPPLHPQNQAAAAAAAAAASGAGLPFRQTCSWMDRHGRPASPPMEYGG---RRSERRDRIRRVE 467
Fly 468 LLIEPGQSLGLMIRGGVEYGLGIFVTGVDKDSVADR-SGLMIGDEILEVNGQSFLDVTHDEAV-- 529
Fly 530 -----GQLKY 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dysc | NP_001261810.1 | PDZ_signaling | 294..380 | CDD:238492 | 7/38 (18%) |
PDZ_signaling | 466..543 | CDD:238492 | 30/77 (39%) | ||
HN_L-whirlin_R2_like | 573..653 | CDD:259823 | |||
PDZ_signaling | 886..971 | CDD:238492 | |||
GOPC | NP_065132.1 | bZIP_2 | <166..199 | CDD:285017 | 5/11 (45%) |
PDZ_signaling | 286..368 | CDD:238492 | 32/80 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 426..449 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |