DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and Tamalin

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_062391.3 Gene:Tamalin / 56149 MGIID:1860303 Length:392 Species:Mus musculus


Alignment Length:207 Identity:49/207 - (23%)
Similarity:72/207 - (34%) Gaps:66/207 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 AAGTAGTLPTSTAASGRSMGQHASSNGNKKRPISPEQVLRMFGAT-QSSSVPTSSYHYS------ 248
            |...||..|.|.||....:            |..|.......||. :........||.:      
Mouse    18 APDPAGRAPDSEAARAAPL------------PSGPPAAAAPPGAPGEELYAALEDYHPAELYRAL 70

  Fly   249 --NGGTRDRDRTGR----RSPASSPPSTTHQIYRDRERERDRSVPNIH---------ELTTRTVS 298
              :|||..| |.|.    ::...||             |:.|.|..:.         |:.|..:.
Mouse    71 AVSGGTLPR-RKGSGFRWKNFTQSP-------------EQQRKVLTLEKGDNQTFGFEIQTYGLH 121

  Fly   299 MSRDQQIDHGFGICVKGGKDSGLGVYISRIEENSVAERAGLRPGDTILEVNGTPFTSINHEEALK 363
            ...:|:::              :..::.|:.|:|.|:.|||.|||||..|||.....|.|.|   
Mouse   122 HREEQRVE--------------MVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHRE--- 169

  Fly   364 RCVQILKSSRQI 375
             .|.|:|:|..:
Mouse   170 -IVDIIKASGNV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 24/82 (29%)
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
TamalinNP_062391.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 10/43 (23%)
PDZ_signaling 99..184 CDD:238492 26/100 (26%)
Interaction with PSCD3. /evidence=ECO:0000269|PubMed:10828067 180..257 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.