Sequence 1: | NP_001261810.1 | Gene: | dysc / 39533 | FlyBaseID: | FBgn0264006 | Length: | 1254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062391.3 | Gene: | Tamalin / 56149 | MGIID: | 1860303 | Length: | 392 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 49/207 - (23%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 66/207 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 AAGTAGTLPTSTAASGRSMGQHASSNGNKKRPISPEQVLRMFGAT-QSSSVPTSSYHYS------ 248
Fly 249 --NGGTRDRDRTGR----RSPASSPPSTTHQIYRDRERERDRSVPNIH---------ELTTRTVS 298
Fly 299 MSRDQQIDHGFGICVKGGKDSGLGVYISRIEENSVAERAGLRPGDTILEVNGTPFTSINHEEALK 363
Fly 364 RCVQILKSSRQI 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dysc | NP_001261810.1 | PDZ_signaling | 294..380 | CDD:238492 | 24/82 (29%) |
PDZ_signaling | 466..543 | CDD:238492 | |||
HN_L-whirlin_R2_like | 573..653 | CDD:259823 | |||
PDZ_signaling | 886..971 | CDD:238492 | |||
Tamalin | NP_062391.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | 10/43 (23%) | |
PDZ_signaling | 99..184 | CDD:238492 | 26/100 (26%) | ||
Interaction with PSCD3. /evidence=ECO:0000269|PubMed:10828067 | 180..257 | 0/1 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..315 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |