DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and slc9a3r1

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001006751.1 Gene:slc9a3r1 / 448423 XenbaseID:XB-GENE-487362 Length:320 Species:Xenopus tropicalis


Alignment Length:241 Identity:54/241 - (22%)
Similarity:89/241 - (36%) Gaps:80/241 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 ICVKGGKDSGLGV-----------YISRIEENSVAERAGLRPGDTILEVNGTPFTSINHEEALKR 364
            :||....|||.|.           |:..:|..|.||:||||.||.::.|.|.....:.|::.:.:
 Frog     6 VCVLEKGDSGYGFHLHSEKTRPGQYVRLVEPGSAAEKAGLRAGDRLIRVCGEDVRELGHQQVVSK 70

  Fly   365 CVQILKSSRQISMTVRAPPTLNSTAPLHGFGPPSRDPMYASMAPPLHPQNQAAAAAAAAAASGAG 429
               |..::.::::.|:.                     ......|..|:.:..|..         
 Frog    71 ---IRAATEKLTLEVQG---------------------VEEEVAPSSPKEENKATE--------- 102

  Fly   430 LPFRQTCSWMDRHGRPASPPMEYGGRRSERRDRIRRVELLIEPGQSLGLMIRGGVEYGL------ 488
                          :..:|.::    |.|.|.|:    ..|:.|.|       |..:.|      
 Frog   103 --------------KQPTPVLD----RKELRPRL----CTIKKGPS-------GFGFNLHSDKVH 138

  Fly   489 -GIFVTGVDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQLK 533
             |.||..||.||.|:.:||:..|.|:||||.:.:...|.:.|..:|
 Frog   139 PGQFVRAVDPDSPAELAGLLPKDRIVEVNGLNVIGKQHGDVVAAIK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 21/79 (27%)
PDZ_signaling 466..543 CDD:238492 24/75 (32%)
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
slc9a3r1NP_001006751.1 PDZ_signaling 4..83 CDD:238492 21/79 (27%)
PDZ_signaling 116..195 CDD:238492 25/80 (31%)
EBP50_C 199..320 CDD:370238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.