DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and CG10939

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster


Alignment Length:282 Identity:65/282 - (23%)
Similarity:101/282 - (35%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 IEPGQSLGLMIRGGVEYGLGIFVTGVDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQLK- 533
            ::|||                |:..||.||.|:.:||..||.||||||.|....||.:.|.::| 
  Fly    43 VKPGQ----------------FIGKVDADSPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKA 91

  Fly   534 YHKRMSLVIRDV-GKVPHSCTSIEMEPWDAYSPTGTRARRKGQIATMVEEKARSLLP--RHHFAS 595
            ....:.|::.|| ||      ::|::|   .||........|..:....|..:..:|  ..:.:|
  Fly    92 IANEVRLLLI
DVDGK------ALEVKP---ASPPAAACNGNGSASQNGYEGTKQEMPGASANISS 147

  Fly   596 LSYYIAEYSAKAMTIDAFVAVLLEMLDTYEKHTLVTEIRELVFPEDRTRYDELVYRRERDPYSVD 660
            :|....:.|:.|.:|.:...:....||.                                   ||
  Fly   148 ISMVSTKRSSNASSIQSGSTMNASDLDV-----------------------------------VD 177

  Fly   661 RHRRKGDPARDLPVTADDLEIIAATGRSPSSDSGLGMTVTDIYKRPALQLPHRPMSAGPILHRSQ 725
            |    |.||...||......:  ..|..|||         .|.....:..|..|.:....::.: 
  Fly   178 R----GIPAVAAPVAITPPPV--QNGSKPSS---------PINNNTLMSTPPPPSATKAGINNN- 226

  Fly   726 PASHYQT---GSNQSSSSLSPP 744
             .|.|.|   |:|..::..:||
  Fly   227 -GSVYNTNGNGTNGMTTPTTPP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492
PDZ_signaling 466..543 CDD:238492 25/73 (34%)
HN_L-whirlin_R2_like 573..653 CDD:259823 10/81 (12%)
PDZ_signaling 886..971 CDD:238492
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.