DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and CG34375

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:357 Identity:74/357 - (20%)
Similarity:129/357 - (36%) Gaps:88/357 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 PLPRIINIHENGAAFEAGGLEVGQLILEVDGTKVEGLHHQEVARLIAECFANREKAEITFLVVEA 973
            |.|.:..:....:| |.||:.:|..:||::|..|.||...|:|..:.:.:  :..||:..|::..
  Fly    26 PYPWVSGVQAKSSA-ERGGVRLGDTLLELNGADVLGLKISELANRLQDHW--QSGAEVVTLMMWR 87

  Fly   974 KKSNLEPKPTALIFLEAXHLLALPASDPLERQKLEFLYEWGIDLTETPKPMPTPIPLTKAKNPPP 1038
            :::|::|....   .|| |.:    ...:.:|.|:   ::...|....:.:..|:.|...| ||.
  Fly    88 QQANIDPNEDP---AEASHAV----QHGINQQSLQ---KFATCLQHISQLLECPVCLEVIK-PPG 141

  Fly  1039 LP----HELHNNINSQY------------GSSAALSNHQPHQHTHPHP------QQQQQQQQHSN 1081
            ..    |.|.||..|:.            .....||:..........|      .:....|.|..
  Fly   142 WQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAESFPCDGGKTNKVAASQGHGK 206

  Fly  1082 TKTPNTNSNKTQGTP-----TTGTGAATTGSK--QQQQPGNTTNTPTKASREATPTREQHH---- 1135
            ..:.|..:|:....|     .|.:|.:..|.:  :|.:......:|.:..|::...:||..    
  Fly   207 LSSVNKCTNEYHNQPKMALAKTSSGKSKCGKQISRQLETVLVDQSPREIRRKSQQGQEQEQAVQE 271

  Fly  1136 -----------QHATPTREHQQQ---------------------TPTRQQQLQREQQQ------Q 1162
                       ||.....||..:                     |...|..|:.::..      |
  Fly   272 AVLPRCTLIKVQHQEAAVEHFSEEGHNNMLVKPKLKLSKKSWRITGPDQDGLRCDEVATINNGVQ 336

  Fly  1163 LQREQQQQHHRDRQQHFREQREQREREYQHEH 1194
            :|.:||||   :|||...|:....|.|||:.|
  Fly   337 VQEQQQQQ---ERQQLGHEKSASSESEYQNYH 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492 18/61 (30%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 18/62 (29%)
RING 129..168 CDD:238093 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.