DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and Cytip

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001012086.1 Gene:Cytip / 311047 RGDID:1307990 Length:359 Species:Rattus norvegicus


Alignment Length:191 Identity:48/191 - (25%)
Similarity:73/191 - (38%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QHASSNGNKKRPISPEQVLRMFGATQSSSVPTSSYHYSNGGTRDRDRTGRRSPASSPPSTTHQIY 275
            |..|||||          |.....:..||.||.:     |.....|  .||....:  .|...:.
  Rat     8 QQQSSNGN----------LEYCADSAYSSYPTLT-----GPLTVED--NRRIQMLA--DTVATLP 53

  Fly   276 RDRER---ERDRSVPNIHELTTRTVSMSRDQQIDHGF----------GICVKGGKDSGLGVYISR 327
            |.|::   .|..|:.:......:.|::.:......||          .||     .|.:...|.:
  Rat    54 RGRKQLALARSSSLGDFSCSQRKVVTVEKQDNGTFGFEIQTYRLQNQNIC-----SSEVCTMICK 113

  Fly   328 IEENSVAERAGLRPGDTILEVNGTPFTSINHEEALKRCVQILKSSRQISMTVRAPPTLNST 388
            ::|:|.|..|||:.||....|||.......|    |:.|.:::||..: :|:.   |||.|
  Rat   114 VQEDSPAHCAGLQVGDIFANVNGVSTEGFTH----KQVVDLIRSSGNL-LTIE---TLNGT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 24/95 (25%)
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
CytipNP_001012086.1 PDZ_signaling 76..161 CDD:238492 24/94 (26%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.