powered by:
Protein Alignment dysc and F28E10.4
DIOPT Version :9
Sequence 1: | NP_001261810.1 |
Gene: | dysc / 39533 |
FlyBaseID: | FBgn0264006 |
Length: | 1254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500590.2 |
Gene: | F28E10.4 / 185067 |
WormBaseID: | WBGene00017902 |
Length: | 324 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 37/68 - (54%) |
Gaps: | 7/68 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 321 LGV-----YISRIEENSVAERAGLRPGDTILEVNGTPF-TSINHEEALKRCVQILKSSRQISMTV 379
||: ::::::.|::|. :....||:|::::|.|. .:.|.:..::..:..|.:..::|..|
Worm 138 LGIIKRRAFVTKVDPNTIAS-SFFGCGDSIMDMSGAPIPMTDNPDNFIREHLSRLSTGAKVSFLV 201
Fly 380 RAP 382
..|
Worm 202 ERP 204
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.