DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and F20D6.1

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_505110.2 Gene:F20D6.1 / 184722 WormBaseID:WBGene00017633 Length:180 Species:Caenorhabditis elegans


Alignment Length:202 Identity:40/202 - (19%)
Similarity:66/202 - (32%) Gaps:78/202 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 RVELLIEPGQSLGLMIRGGVEYGLGIFVTGVDKD-SVADRSGLMIGDEILEVNGQSFLDVTHDEA 528
            ::.|:..|...||:.::   .|...::|...|.. ....|..|.:||.||.::....||:     
 Worm     4 KLVLIYFPRSKLGINVK---SYQNVVYVESTDNTWGSTTRRFLYLGDAILRIDDTEILDL----- 60

  Fly   529 VGQLKYHKRMSLVIRDVGKVPHSCTSIEMEPWDAYSPTGTRARR----KGQIATMVEEKA----- 584
                                                ||...|.|    |..:.|::.|:|     
 Worm    61 ------------------------------------PTTQNALRTGFSKNGVVTIIVERAVHQES 89

  Fly   585 ----RS----------LLPRHHF----ASLSYY----IAEYSA--KAMTIDAFVAVLLEMLDTYE 625
                ||          :||:...    |.|:|:    .||.:.  |..|.|...|..:.:.:|.|
 Worm    90 YAFVRSVMGFSKVLDPMLPQDVIQTCTARLAYHNKHGFAEPTPIFKGYTKDYSSAGRVSVTNTVE 154

  Fly   626 KHTLVTE 632
            ..::.||
 Worm   155 IKSIRTE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492
PDZ_signaling 466..543 CDD:238492 15/77 (19%)
HN_L-whirlin_R2_like 573..653 CDD:259823 21/89 (24%)
PDZ_signaling 886..971 CDD:238492
F20D6.1NP_505110.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.