DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and mics-1

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001343863.1 Gene:mics-1 / 179475 WormBaseID:WBGene00011890 Length:293 Species:Caenorhabditis elegans


Alignment Length:199 Identity:52/199 - (26%)
Similarity:84/199 - (42%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ISPEQVLRMFGATQSSSVPTSSYH---YSNGGTRDRDRTGRRSPASSPPSTTHQIYRDRERERD- 283
            :||.|...:|   .:.|.|...:|   .|:....|.|.|...|.|:.  :|....:.|...:.: 
 Worm     3 VSPPQEDTVF---NTDSDPVYEHHAALVSSPFHADEDHTFDISFAAE--ATDDMTFNDTTTDGNG 62

  Fly   284 -RSVPNIHELTTRTVSMSRDQQIDHGFGICVKGGKDS-----GLGVYISRIEENSVAERAG-LRP 341
             .||| :..||...:     ::...|||..:.||.|:     .:|:|:|.:  ||.::..| :|.
 Worm    63 QESVP-LEALTVVEI-----EKTSKGFGFNIVGGTDNPHFVGDIGIYVSSV--NSESKSYGVVRT 119

  Fly   342 GDTILEVNGTPFTSINHEEALK--RCVQI--------------LKSSR------QISMTVRAPPT 384
            ||.||..:|...|...|:||::  |.|:|              |:..|      .:|:|.:..|.
 Worm   120 GDKILSFDGIDMTYKTHDEAVEVFRSVKIGHVAKMLIDREYLHLQEDRTQTPTASVSITPQVTPQ 184

  Fly   385 LNST 388
            ..||
 Worm   185 TRST 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 29/113 (26%)
PDZ_signaling 466..543 CDD:238492
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
mics-1NP_001343863.1 PDZ_signaling 71..145 CDD:238492 24/80 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.