DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dysc and Pdzd3

DIOPT Version :9

Sequence 1:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_573489.2 Gene:Pdzd3 / 170761 MGIID:2429554 Length:498 Species:Mus musculus


Alignment Length:334 Identity:81/334 - (24%)
Similarity:131/334 - (39%) Gaps:94/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 ERDRSVP-NIHELTTRTVSMSRDQQIDHGFGICVKGGKDSGLGVYISRIEENSVAERAGLRPGDT 344
            ::|:|.| |:|.  .|...:|::::...||.:....||...:   :.|::..:.|:|.|||.||.
Mouse    35 DQDQSDPWNLHR--PRFCLLSKEEEKTFGFHLQQHLGKADHV---VCRVDPGTSAQRQGLREGDR 94

  Fly   345 ILEVNGTPFTSINHEEALKRCVQILKSSRQISMTVRAP-----------------PTLNS-TAP- 390
            ||.||.   ..:.||:.......|..|..::.:||.|.                 |||.| ..| 
Mouse    95 ILAVNN---NIVAHEDHAVVVRYIRASGPRVLLTVLAQHVHDVARVLQGSDAFLCPTLPSGVRPR 156

  Fly   391 -LH------GFG----PPSRDPMYASMAPPLHPQNQAAAAAAAAAA------------------- 425
             .|      |||    ..||.|.:..::        |..||..|..                   
Mouse   157 LCHVVKDEGGFGFSVTHGSRGPFWLVLS--------AGGAAERAGVPPGARLLEVNGASVEKLTY 213

  Fly   426 ---------SG-------AGLPFRQTCSWMDRHGRPASPPMEYGGRRSERRDRIRRVELLIEPG- 473
                     ||       |||...:.|..:   |.|.:.|:..|.....:...:.     ||.| 
Mouse   214 NQLNRKLWQSGDQVTLLVAGLEVEEQCHQL---GMPLAAPLAEGWALPAKPRCLN-----IEKGP 270

  Fly   474 QSLGLMIR--GGVEYGLGIFVTGVDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQLKYH- 535
            :..|.::|  .|::..||.|:..||....||::|:..||.::.|.|:|...:.|:|.|.:::.. 
Mouse   271 EGFGFLLREEKGLDGRLGQFLWDVDPGLPADKAGMKAGDRLVAVAGESVDGLGHEETVSRIRAQG 335

  Fly   536 KRMSLVIRD 544
            ..:||::.|
Mouse   336 SCVSLIVVD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492 23/85 (27%)
PDZ_signaling 466..543 CDD:238492 24/80 (30%)
HN_L-whirlin_R2_like 573..653 CDD:259823
PDZ_signaling 886..971 CDD:238492
Pdzd3NP_573489.2 PDZ_signaling 47..127 CDD:238492 23/85 (27%)
PDZ_signaling 155..232 CDD:238492 14/84 (17%)
PDZ 260..345 CDD:214570 25/90 (28%)
PDZ_signaling 407..471 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.